(data stored in SCRATCH zone)

EMBL: AL009126.LYXE

AL009126.LYXE        Location/Qualifiers
FT   CDS_pept        472585..473088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lyxE"
FT                   /locus_tag="BSU_04200"
FT                   /old_locus_tag="BSU04200"
FT                   /product="D-lyxose ketol isomerase"
FT                   /EC_number="5.3.1.15"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10220166, 15805528, 21421786,
FT                   21520290; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12227"
FT                   /db_xref="GOA:P96578"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:2Y0O"
FT                   /db_xref="SubtiList:BG12053"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96578"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10220166, 15805528, 21421786, 21520290"
FT                   /protein_id="CAB12227.1"
FT                   /translation="MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLF
FT                   VYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPK
FT                   VLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFT
FT                   DPRI"
     atgggcatca cgaaagaaga agtgaacagc tactatcaaa aagcagggat tgtattaacg        60
     gacgaggaag tagaccaaat ccagctgatg gattacggct taggaaaaga aagaaaagtc       120
     gggctccagc tcttcgtcta cgtcaataca gaccgttatt gttcaaagga attggtgctg       180
     tttccgggac agacttgccc ggaacaccgc catccaccgg tcgacggcca ggaaggcaag       240
     caggagacct tccgctgccg ctacggaaaa gtgtatcttt acgtagaagg agaaaaaacg       300
     ccgcttccaa aagttctccc tcctcaggaa gacagagaac actatacggt ctggcacgaa       360
     attgagctag aaccgggcgg gcaatacacg attccaccaa acacaaagca ttggttccag       420
     gccggggaag aaggtgccgt cgtgacggaa atgtcatcga cgagcacgga taaacatgat       480
     atctttaccg atccaagaat ataa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page