(data stored in ACNUC7421 zone)

EMBL: AL009126.MAPA

AL009126.MAPA        Location/Qualifiers
FT   CDS_pept        146527..147273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mapA"
FT                   /locus_tag="BSU_01380"
FT                   /old_locus_tag="BSU01380"
FT                   /product="methionine aminopeptidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.11.18"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16207374, 22720735; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11914"
FT                   /db_xref="GOA:P19994"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="SubtiList:BG10447"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19994"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16207374, 22720735"
FT                   /protein_id="CAB11914.1"
FT                   /translation="MIICKTPRELGIMREAGRIVALTHEELKKHIKPGISTKELDQIAE
FT                   RFIKKQGAIPSFKGYNGFRGSICVSVNEELVHGIPGSRVLKDGDIISIDIGAKLNGYHG
FT                   DSAWTYPVGNISDDDKKLLEVTEESLYKGLQEAKPGERLSNISHAIQTYVENEQFSVVR
FT                   EYVGHGVGQDLHEDPQIPHYGPPNKGPRLKPGMVLAIEPMVNAGSRYVKTLADNWTVVT
FT                   VDGKKCAHFEHTIAITETGFDILTRV"
     atgattatct gtaaaacccc acgtgaactt ggtatcatgc gggaagcagg gcgaatcgtg        60
     gctttaactc atgaagagtt aaaaaagcac attaaaccag gaatctcgac aaaagaattg       120
     gatcaaattg ccgaacgttt tattaagaag cagggtgcaa tcccatcttt taaggggtat       180
     aatgggtttc gcgggagcat ttgcgtatca gttaatgaag aactcgttca cggcatacct       240
     ggcagcaggg tgctgaagga cggtgacatc atcagtattg atatcggtgc taaattaaat       300
     ggttatcatg gtgactctgc atggacatat ccggtaggaa acatcagcga tgatgacaaa       360
     aaacttctgg aagtgacaga ggagtcttta tataaaggct tgcaggaagc aaaaccaggt       420
     gaacgtttgt cgaatatttc ccacgcaata caaacgtatg tcgaaaatga gcagttttca       480
     gttgttaggg agtatgtcgg acatggtgtt ggtcaagact tgcatgagga cccgcaaatt       540
     cctcattacg gtccgcccaa caaaggacca cggcttaaac ctggcatggt tctcgctatt       600
     gaacctatgg tgaacgctgg cagccgctac gtgaaaacat tggctgataa ctggacggtt       660
     gtaacggtag atgggaaaaa gtgtgctcat tttgaacata cgattgcgat tacggaaacg       720
     ggttttgata tactgacgag agtctag                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page