(data stored in ACNUC7421 zone)

EMBL: AL009126.MCSA

AL009126.MCSA        Location/Qualifiers
FT   CDS_pept        101927..102484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsA"
FT                   /locus_tag="BSU_00840"
FT                   /old_locus_tag="BSU00840"
FT                   /product="activator of protein kinase McsB"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16163393, 19189946, 24947607;
FT                   Product type f: factor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00840"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11860"
FT                   /db_xref="GOA:P37569"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="SubtiList:BG10146"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37569"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16163393, 19189946, 24947607"
FT                   /protein_id="CAB11860.1"
FT                   /translation="MICQECHERPATFHFTKVVNGEKIEVHICEQCAKENSDSYGISAN
FT                   QGFSIHNLLSGLLNMDSSFQNAGTQMFSHSEQISACPKCGMTFQQFRKIGRFGCSECYK
FT                   TFHSNITPILRKVHSGNTVHAGKIPKRIGGNLHVRRQIDMLKKELESLIHQEEFENAAH
FT                   VRDQIRLLEQSLKSTDSEEEQE"
     ttgatttgtc aagagtgcca cgagagacca gccacttttc actttacaaa ggttgttaac        60
     ggagaaaaaa tagaagttca tatttgtgaa caatgtgcca aagaaaatag tgattcatat       120
     ggtataagtg caaatcaggg tttctctatt cataatttac tttcgggttt actgaacatg       180
     gattcttcat ttcaaaatgc aggaactcaa atgttcagtc actcggagca aatatctgct       240
     tgtccgaaat gcggaatgac ttttcagcaa ttcagaaaaa ttggccgttt tggatgttct       300
     gaatgttaca aaacatttca tagcaacatt acaccaatcc tacgtaaagt gcacagcgga       360
     aacactgtgc atgcaggtaa gataccgaaa cgaataggcg gcaatcttca tgtcagacgg       420
     cagattgata tgctaaaaaa ggaattagaa tccttaatcc atcaagaaga atttgaaaat       480
     gcagctcatg taagagatca aattcgttta ttagaacaat cactcaaaag tacagatagt       540
     gaggaggaac aggagtaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page