(data stored in ACNUC7421 zone)

EMBL: AL009126.MCSB

AL009126.MCSB        Location/Qualifiers
FT   CDS_pept        102484..103575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BSU_00850"
FT                   /old_locus_tag="BSU00850"
FT                   /product="protein arginine kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.3.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16163393, 17380125, 19189946,
FT                   21622759, 25610436, 27749819; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00850"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11861"
FT                   /db_xref="GOA:P37570"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="SubtiList:BG10147"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37570"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16163393, 17380125, 19189946, 21622759, 25610436,
FT                   27749819"
FT                   /protein_id="CAB11861.1"
FT                   /translation="MSLKHFIQDALSSWMKQKGPESDIVLSSRIRLARNFEHIRFPTRY
FT                   SNEEASSIIQQFEDQFSEQEIPGIGKFVLIRMNDAQPLEKRVLVEKHLISPNLTESPFG
FT                   GCLLSENEEVSVMLNEEDHIRIQCLFPGFQLLEAMKAANQVDDWIEEKVDYAFNEQRGY
FT                   LTSCPTNVGTGLRASVMMHLPALVLTRQINRIIPAINQLGLVVRGIYGEGSEAVGNIFQ
FT                   ISNQITLGKSEQDIVEDLNSVAAQLIEQERSAREAIYQTSKIELEDRVYRSYGVLSNCR
FT                   MIESKETAKCLSDVRLGIDLGIIKGLSSNILNELMILTQPGFLQQYSGGALRPNERDIR
FT                   RAALIRERLHLEMNGKRQEDESI"
     atgtcgctaa agcattttat tcaggacgca ctaagcagtt ggatgaagca gaaaggacct        60
     gaaagtgaca ttgtactcag cagccgcata cgtttagcaa gaaactttga gcatattcgg       120
     ttccctacgc ggtattccaa tgaagaagcc tcatccatca tacagcaatt tgaagatcag       180
     ttttcagagc aagaaattcc cggaatcggc aaatttgttt tgattagaat gaatgatgca       240
     cagcctttag aaaagcgtgt acttgttgaa aaacatctaa tcagcccgaa tttgacagag       300
     tctccttttg gcggctgttt gctttctgaa aatgaggaag taagcgtcat gctaaatgaa       360
     gaggaccata ttagaattca gtgtcttttc cctggatttc agcttttaga agcaatgaaa       420
     gccgcaaacc aggtcgacga ctggattgaa gaaaaagttg attatgcatt caatgagcaa       480
     agaggatact taaccagctg tcctacaaac gtaggtactg gtttaagggc ttcggtcatg       540
     atgcatctgc cggcgctggt tttaactagg caaataaatc gaattatacc ggcaattaat       600
     caattaggct tagttgttag aggaatttat ggggaaggca gcgaagcagt agggaatatc       660
     tttcaaattt caaatcagat cacgcttggt aagtcagagc aggatattgt agaggatctt       720
     aacagtgttg ctgctcagtt gattgaacaa gaacgatctg cccgagaagc gatttatcaa       780
     acttctaaaa tcgaacttga ggatcgggta tatcggtcat atggggtctt gtctaattgc       840
     cggatgatag aatcgaaaga aactgcaaag tgcctttcag atgttcggtt aggcatagac       900
     ttaggcataa taaaaggact ttcaagcaac atacttaacg aacttatgat tttgacgcag       960
     ccagggtttt tacagcaata ctcgggaggc gctttgcgac cgaacgaaag ggacattcga      1020
     agagcggctc tcatcagaga acggcttcac ttagaaatga atgggaaaag acaggaggat      1080
     gaatcgatat ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page