(data stored in ACNUC7421 zone)

EMBL: AL009126.METS

AL009126.METS        Location/Qualifiers
FT   CDS_pept        45633..47627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BSU_00380"
FT                   /old_locus_tag="BSU00380"
FT                   /product="methionyl-tRNA synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.1.1.10"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 11233169, 12682299, 12792655;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00380"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11814"
FT                   /db_xref="GOA:P37465"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="SubtiList:BG10101"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37465"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11814.1"
FT                   /translation="MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFD
FT                   VRYLTGTDEHGQKIQQKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHK
FT                   VVIEKVFQKLLDNGDIYLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGH
FT                   PVELIKEESYFFRMGKYADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTT
FT                   FDWGVKVPENPKHVVYVWIDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHT
FT                   IYWPIMLMALDLPLPKQVFAHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLR
FT                   EVPFGSDGVFTPEGFVERINYDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDHT
FT                   LTSVAEETVKAYEKAMENMEFSVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRS
FT                   VMYHLAESLRISAVLLQPFLTKTPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGE
FT                   PLFPRLEAEEEIAYIKGKMQGSAPAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVI
FT                   EAEPVKKADRLLKLQLDLGFEKRQVVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELS
FT                   QGMILAGEADGVLKVVSIDQSLPKGTRIK"
     atgccgcaag aaaacaatac attttacatt acaacaccga tttattatcc gagcggaaaa        60
     ttacatatcg gccatgcata tacgacagtc gcaggagatg caatggcacg ttacaaaaga       120
     ttaaaagggt tcgatgttcg ctatttaacg ggaacggacg agcatggaca aaagatccag       180
     caaaaagctg aacaggaaaa cattacacct caggagtatg tggatcgcgc agcggcagat       240
     attcaaaaac tgtggaagca gcttgaaatc tcaaacgacg actttatccg cacgacagaa       300
     aaacggcata aagttgtcat tgaaaaagtg tttcaaaagc ttcttgataa cggggacatc       360
     tatcttgatg agtatgaagg ctggtacagc atccctgatg aaacgttcta cacggaaact       420
     cagctcgttg atattgagcg gaatgaaaag ggagaggtca tcggcggaaa aagccctgac       480
     agcggtcacc cagttgaatt gatcaaagag gaatcttatt tcttccgcat ggggaaatac       540
     gcggatcgtc ttctgaaata ctatgaagaa aacccgacat tcattcagcc agaatcacgc       600
     aaaaacgaaa tgattaataa ctttatcaaa cctggacttg aggatttggc agtatcacgt       660
     accacttttg attggggcgt gaaggtgccg gaaaatccaa agcatgttgt atatgtttgg       720
     attgacgcac tatttaacta tttaacggca ctcggttatg atacagaaaa tgatgagctt       780
     tatcaaaaat attggcctgc cgatgttcat ttagtcggta aggagattgt acgattccat       840
     actatttact ggccaattat gctgatggcg ctggatcttc cgctgccaaa gcaagtattc       900
     gcgcatggct ggcttttgat gaaagacgga aaaatgtcga aatcaaaagg aaacgttgta       960
     gatccggtta cattaattga acgctatggt ttagacgaac ttcgctatta cttgcttcgc      1020
     gaagtgccgt tcggatcaga cggtgttttc acgccggaag gatttgttga gcgaatcaac      1080
     tatgatttag cgaatgattt aggaaatcta ttgaatcgta ctgttgcgat gattaataag      1140
     tattttgacg gacaaatcgg ttcttacaaa ggtgctgtta cggaatttga ccatacgctc      1200
     acttctgttg ctgaagaaac agtgaaagct tatgagaaag caatggaaaa tatggagttc      1260
     tcggtagcac tttcgacttt atggcagctc atcagccgca caaacaaata cattgatgag      1320
     acagctccat gggtgcttgc gaaagatccg gcaaaagaag aagaattgcg atcagttatg      1380
     tatcatctcg ctgaatcatt gcgtatttca gcggtactgc ttcagccatt cttaacaaaa      1440
     acacctgaaa aaatgttcga gcagctgggc attactgatg aatctttaaa agcttgggac      1500
     agcattacag ctttcggcca gctgaaagat acaaaagtac aaaaaggcga gccattgttc      1560
     cctcgtttag aggcagaaga agaaattgct tacatcaaag ggaaaatgca aggttcagca      1620
     ccagcgaaag aagaaacaaa agaagaagag cctcaagagg tcgatcgttt acctgaaatt      1680
     acgattgatc aatttatgga tgtagagctt cgcgtagctg aggtcattga ggcagagcca      1740
     gtgaaaaaag cagaccgttt attgaagctg cagcttgatc ttggttttga aaagcgccaa      1800
     gtggtatccg gcattgcgaa gcattatacg cctgaagagc ttgttggaaa aaaactcgtt      1860
     tgtgtaacaa atctaaaacc ggttaaactc agaggagagc tttctcaagg tatgatcctt      1920
     gcaggagaag cagacggcgt tttaaaggtc gtatctatcg atcagtcgtt accaaaaggc      1980
     acaagaatta aataa                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page