(data stored in SCRATCH zone)

EMBL: AL009126.MPR

AL009126.MPR         Location/Qualifiers
FT   CDS_pept        245190..246131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /locus_tag="BSU_02240"
FT                   /old_locus_tag="BSU02240"
FT                   /product="extracellular glutamyl-endopeptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 1c: Function from experimental evidences in
FT                   the studied genus; PubMedId: 15205417, 15375126, 21819557,
FT                   25666135; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02240"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12018"
FT                   /db_xref="GOA:P39790"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="SubtiList:BG10690"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39790"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12018.1"
FT                   /translation="MKLVPRFRKQWFAYLTVLCLALAAAVSFGVPAKAAENPQTSVSNT
FT                   GKEADATKNQTSKADQVSAPYEGTGKTSKSLYGGQTELEKNIQTLQPSSIIGTDERTRI
FT                   SSTTSFPYRATVQLSIKYPNTSSTYGCTGFLVNPNTVVTAGHCVYSQDHGWASTITAAP
FT                   GRNGSSYPYGTYSGTMFYSVKGWTESKDTNYDYGAIKLNGSPGNTVGWYGYRTTNSSSP
FT                   VGLSSSVTGFPCDKTFGTMWSDTKPIRSAETYKLTYTTDTYGCQSGSPVYRNYSDTGQT
FT                   AIAIHTNGGSSYNLGTRVTNDVFNNIQYWANQ"
     atgaaattag ttccaagatt cagaaaacaa tggttcgctt acttaacggt tttgtgtttg        60
     gctttggcag cagcggtttc ttttggcgta ccggcaaaag cggcagagaa cccgcaaact       120
     tctgtatcga ataccggtaa agaagctgat gctacgaaaa accaaacgtc aaaagcagat       180
     caggtttccg ccccttatga gggaaccgga aaaacaagta aatcgttata cggcggccaa       240
     acggaactgg aaaaaaacat tcaaacctta cagccttcga gcattatcgg aactgatgaa       300
     cgcaccagaa tctccagcac gacatctttt ccatatagag caaccgttca actgtcaatc       360
     aagtatccca acacttcaag cacttatgga tgtaccggat ttttagtcaa tccaaataca       420
     gtcgtcacgg ctggacattg tgtgtacagc caggatcatg gatgggcttc gacgataacc       480
     gccgcgccgg gccgcaatgg ttcgtcatat ccgtacggta cttattcagg cacgatgttt       540
     tactccgtca aaggatggac ggaaagcaaa gacaccaact atgattacgg agctattaaa       600
     ttaaacggtt ctcctggaaa cacggttggc tggtacggct accggactac aaacagcagc       660
     agtcccgtgg gcctttcctc gtcagtgaca ggattcccat gtgacaaaac ctttggcacg       720
     atgtggtctg atacaaagcc gattcgctcc gctgaaacgt ataagctgac ctatacaacc       780
     gatacgtacg gctgccaaag cggctcgcct gtttatcgaa actacagtga tacagggcag       840
     acagctattg ccattcacac gaacggagga tcgtcatata acttgggaac aagggtgacg       900
     aacgatgtat tcaacaatat tcaatattgg gcaaatcaat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page