(data stored in SCRATCH zone)

EMBL: AL009126.MRNC

AL009126.MRNC        Location/Qualifiers
FT   CDS_pept        114854..115285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrnC"
FT                   /locus_tag="BSU_00950"
FT                   /old_locus_tag="BSU00950"
FT                   /product="ribonuclease for 23S RNA maturation, mini-RNase
FT                   III"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16014871, 25634891, 27924926;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00950"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11871"
FT                   /db_xref="GOA:O31418"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="PDB:4OUN"
FT                   /db_xref="SubtiList:BG12702"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31418"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16014871, 25634891, 27924926"
FT                   /protein_id="CAB11871.1"
FT                   /translation="MLEFDTIKDSKQLNGLALAYIGDAIFEVYVRHHLLKQGFTKPNDL
FT                   HKKSSRIVSAKSQAEILFFLQNQSFFTEEEEAVLKRGRNAKSGTTPKNTDVQTYRYSTA
FT                   FEALLGYLFLEKKEERLSQLVAEAIQFGTSGRKTNESAT"
     atgcttgaat ttgatacgat aaaagattct aagcagctta acggtcttgc gcttgcttat        60
     ataggtgatg ccatttttga agtgtatgtc aggcatcacc tgcttaagca gggctttacc       120
     aaaccaaatg atcttcataa gaaatcaagc cggattgttt cagcaaagtc acaggctgag       180
     atcctatttt ttctgcagaa tcaatcattt tttacggaag aagaggaagc ggtgctgaaa       240
     agaggcagaa atgccaagtc agggacaaca cctaaaaata cagatgttca gacgtaccgc       300
     tacagtacag catttgaagc gcttctgggc tacctttttc tagagaaaaa agaggaacga       360
     cttagtcagc tcgtagccga agctatacaa ttcgggacgt cagggaggaa aacaaatgag       420
     tcagcaacat ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page