(data stored in SCRATCH zone)

EMBL: AL009126.MTLA

AL009126.MTLA        Location/Qualifiers
FT   CDS_pept        449724..451160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlA"
FT                   /locus_tag="BSU_03981"
FT                   /old_locus_tag="BSU03981"
FT                   /product="phosphotransferase system (PTS) mannitol-specific
FT                   enzyme IICB component"
FT                   /function="16.1: Circulate"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.197"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 23279188; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03981"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12206"
FT                   /db_xref="GOA:P42956"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="SubtiList:BG11215"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42956"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 23279188"
FT                   /protein_id="CAB12206.2"
FT                   /translation="MQQQEQQQGGMKVKVQRFGSYLSGMIMPNIGAFIAWGIITALFIP
FT                   AGWFPNEQLNTLVSPMITYLLPLLIAYTGGKMIYDHRGGVVGATAAIGVIVGSDIPMFL
FT                   GAMIMGPLGGYLIKQTDKLFKDKVKQGFEMLINNFTAGIVGAALTILAFYAIGPVVLTL
FT                   NKLLAAGVEVIVHANLLPVASVFVEPAKVLFLNNAINHGILSPIGIEQASQTGKSILFL
FT                   VEANPGPGLGILLAYMFFGKGSSKSTAPGAAIIHFFGGIHEIYFPYILMKPALILAAIA
FT                   GGASGLLTFTIFNAGLVAAASPGSIIALMAMTPRGGYFGVLAGVLVAAAVSFIVSAVIL
FT                   KSSKASEEDLAAATEKMQSMKGKKSQAAAALEAEQAKAEEASELSPESVNKIIFACDAG
FT                   MGSSAMGASILRNKVKKAELDISVTNTAINNLPSDADIVITHKDLTDRAKAKLPNATHI
FT                   SVDNFLNSPKYDELIEKLKK"
     atgcagcagc aagaacagca gcaaggcggc atgaaagtga aagtgcaacg ctttgggagt        60
     tatttgagcg gaatgatcat gccgaatatc ggcgcgttta tcgcgtgggg tatcattacc       120
     gcgctgttta ttccggcagg atggtttccg aatgaacagc tgaacacgct ggtcagcccg       180
     atgattacgt atttattgcc gcttttgata gcgtatacag gcggaaaaat gatctacgac       240
     caccgcggcg gagttgtcgg agcgacagcg gcaattgggg tgattgtagg atcggatatt       300
     ccaatgtttt taggcgcaat gattatgggt ccgcttggcg gatacctcat taaacagact       360
     gataaattat tcaaggataa agtcaagcaa ggctttgaaa tgctgatcaa caactttacg       420
     gcagggattg tcggcgcggc tttaacgatt ctcgcgtttt acgccatcgg cccggttgtc       480
     ttgacgctaa ataaattgct ggcggctggt gtggaagtca ttgtacacgc taatttactg       540
     ccggtagcca gtgtttttgt agaaccggcg aaagtgttgt tccttaacaa cgccataaac       600
     catggaatct taagcccgat cggaatcgag caagcatctc aaacaggaaa atcaattctg       660
     tttttagtag aagcaaaccc tggaccgggg ctcggcattt tgctggccta catgttcttt       720
     ggcaaaggat cttcaaaatc aacggctccc ggtgcggcga tcatccattt cttcggaggg       780
     attcacgaga tttacttccc gtacattctg atgaaaccgg ccctgattct cgcagccatt       840
     gccggcggag caagcggact cttaacattt acgatcttta atgccggact tgtcgcggca       900
     gcgtcaccgg gaagcattat cgcattgatg gcaatgacgc caagaggagg ctatttcggc       960
     gtattggcgg gtgtattggt cgctgcagct gtatcgttca tcgtttcagc agtgatcctg      1020
     aaatcctcta aagctagtga agaagacctg gctgccgcaa cagaaaaaat gcagtccatg      1080
     aaggggaaga aaagccaagc agcagctgct ttagaggcgg aacaagccaa agcagaagaa      1140
     gcgtctgagc tgtctcctga aagcgtgaac aaaattatct ttgcgtgtga tgcgggaatg      1200
     ggatcaagtg ccatgggggc atccatctta agaaacaaag tgaaaaaagc ggagcttgac      1260
     atcagtgtga ccaacacggc cattaacaat ctgccaagcg atgcggatat tgtcatcacc      1320
     cacaaagatt taacagaccg cgcgaaagca aagctgccga acgcgacgca catatcagtg      1380
     gataacttct taaacagccc gaaatacgac gagctgattg aaaagctgaa aaagtaa         1437
//

If you have problems or comments...

PBIL Back to PBIL home page