(data stored in SCRATCH zone)

EMBL: AL009126.MTLD

AL009126.MTLD        Location/Qualifiers
FT   CDS_pept        451618..452739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="BSU_03990"
FT                   /old_locus_tag="BSU03990"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.1.1.17"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 22014119, 23279188;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03990"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12207"
FT                   /db_xref="GOA:P42957"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="SubtiList:BG11216"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42957"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 22014119, 23279188"
FT                   /protein_id="CAB12207.2"
FT                   /translation="MIALHFGAGNIGRGFIGALLHHSGYDVVFADVNETMVSLLNEKKE
FT                   YTVELAEEGRSSEIIGPVSAINSGSQTEELYRLMNEAALITTAVGPNVLKLIAPSIAEG
FT                   LRRRNTANTLNIIACENMIGGSSFLKKEIYSHLTEAEQKSVSETVGFPNSAVDRIVPIQ
FT                   HHEDPLKVSVEPFFEWVIDESGFKGKTPVINGALFVDDLTPYIERKLFTVNTGHAVTAY
FT                   VGYQRGLKTVKEAIDHPEIRRVVHSALLETGDYLVKSYGFKQTEHEQYIKKIIGRFENP
FT                   FISDDVTRVARSPLRKLGENDRLVGPAKKIKEPNALAEGIAAALRFDFTGDPEAVELQA
FT                   LIEEKGYSGVLQEVCGIQSHEPLHAIILKKLNQ"
     atgatcgcct tacatttcgg tgcgggaaat atcgggagag gatttatcgg cgcgctgctt        60
     caccactccg gctatgatgt ggtgtttgcg gatgtgaacg aaacgatggt cagcctcctc       120
     aatgaaaaaa aagaatacac agtggaactg gcggaagagg gacgttcatc ggagatcatt       180
     ggcccggtga gcgctattaa cagcggcagt cagaccgagg agctgtaccg gctgatgaat       240
     gaggcggcgc tcatcacaac agctgtcggc ccgaatgtgc tgaagctgat tgccccgtct       300
     atcgcagaag gtttaagacg aagaaatact gcaaacacac tgaatatcat tgcctgcgaa       360
     aatatgattg gcggaagcag cttcttaaag aaagaaatat acagccattt aacggaagca       420
     gagcagaaat ccgtcagtga aacggtaggt tttccgaatt ctgccgttga ccggatcgtc       480
     ccgattcagc atcatgaaga cccgctgaaa gtatcggttg aaccattttt cgaatgggtc       540
     attgatgaat caggctttaa agggaaaaca ccagtcataa acggcgcact gtttgttgat       600
     gatttaacgc cgtacatcga acggaagctg tttacggtca ataccggaca cgcggtcaca       660
     gcgtatgtcg gctatcagcg cggactcaaa acggtcaaag aagcaattga tcatccggaa       720
     atccgccgtg ttgttcattc ggcgctgctt gaaactggtg actatctcgt caaatcgtat       780
     ggctttaagc aaactgaaca cgaacaatat atcaaaaaaa tcatcggtcg ctttgaaaat       840
     cctttcattt cggacgatgt gacccgcgta gcgaggtcac ctctcagaaa actgggagaa       900
     aatgatagac ttgtaggccc ggcaaagaaa ataaaagaac cgaatgcact ggctgaagga       960
     attgccgcag cactgcgctt cgatttcacc ggtgaccctg aagcggttga actgcaagcg      1020
     ctgatcgaag aaaaaggata cagcggcgta cttcaagagg tgtgcggcat tcagtcccat      1080
     gaaccgttgc acgccatcat tttaaagaaa cttaatcaat aa                         1122
//

If you have problems or comments...

PBIL Back to PBIL home page