(data stored in ACNUC7421 zone)

EMBL: AL009126.MTLF

AL009126.MTLF        Location/Qualifiers
FT   CDS_pept        451185..451616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlF"
FT                   /locus_tag="BSU_03982"
FT                   /old_locus_tag="BSU03982"
FT                   /product="phosphotransferase system (PTS) mannitol-specific
FT                   enzyme IIA component"
FT                   /function="16.1: Circulate"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="2.7.1.197"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12897001, 23279188; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03982"
FT                   /db_xref="EnsemblGenomes-Tr:CAX52549"
FT                   /db_xref="GOA:C0H3V2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0H3V2"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12897001, 23279188"
FT                   /protein_id="CAX52549.1"
FT                   /translation="MQVLAKENIKLNQTVSSKEEAIKLAGQTLIDNGYVTEDYISKMFE
FT                   REETSSTFMGNFIAIPHGTEEAKSEVLHSGISIIQIPEGVEYGEGNTAKVVFGIAGKNN
FT                   EHLDILSNIAIICSEEENIERLISAKSEEDLIAIFNEVN"
     atgcaagtac tcgcaaagga aaacattaaa ctcaatcaaa cggtatcatc aaaagaagag        60
     gctatcaaat tggcaggcca gacgctgatt gacaacggct acgtgacaga ggattacatt       120
     agcaaaatgt ttgaacgtga agaaacgtct tctacgttta tggggaattt cattgccatt       180
     ccacacggca cagaagaagc gaaaagcgag gtgcttcact caggaatttc aatcatacag       240
     attccagagg gcgttgagta cggagaaggc aacacggcaa aagtggtatt cggcattgcg       300
     ggtaaaaata atgagcattt agacattttg tctaacatcg ccattatctg ttcagaagaa       360
     gaaaacattg aacgcctgat ctccgctaaa agcgaagaag atttgatcgc cattttcaac       420
     gaggtgaact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page