(data stored in SCRATCH zone)

EMBL: AL009126.MURP

AL009126.MURP        Location/Qualifiers
FT   CDS_pept        complement(189790..191157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murP"
FT                   /locus_tag="BSU_01680"
FT                   /old_locus_tag="BSU01680"
FT                   /product="N-acetylmuramic acid PTS permease-MurP subunit"
FT                   /function="16.1: Circulate"
FT                   /EC_number="2.7.1.192"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15060041, 15849754, 16850406,
FT                   10627040, 20400549, 22960854; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01680"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11944"
FT                   /db_xref="GOA:Q797S1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="SubtiList:BG11567"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q797S1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11944.3"
FT                   /translation="MSKENNYHHLAQKILELCGGKSNISSYTHCMTRLRITPYDESKAD
FT                   AQALRKLDGVLGVVEAETLQIILGTGVVNHVTAAFSKLVSAEEGADVKEAAAKKKADIN
FT                   RKNATPFKLFLRKIASIFIPLIPALVASGLITGITKAIIQAGWLSADSQIAIILTVIGS
FT                   GLFTYLGILVGINASKEFGGTPALGALAGILIINPEIAKISLFGEELLPGRGGLIGVLF
FT                   AAIFIAYTEQFIRRFIPQSLDIIVTPTVSLLITGIVTYVVFMPLGGFISDAITSGLLSI
FT                   LDIGGIAAGFILGATFLPLVVTGLHQGLTPVHMELINSIGNDPLLPILAMGGAGQVGAA
FT                   FAVFVKTKKTTLRKAIAGGLPSGLLGIGEPLIFGVTLPLGRPFLTACLGAGIGGAFQAY
FT                   FQVATIAIGVSGLPLSFLVLPSQIILYIVGLFISYAAGFLLTYAFGYKDEMASQFD"
     atgagcaaag aaaataacta ccatcatctc gcacagaaaa tccttgagct atgcggagga        60
     aaatccaata tttcttcata tacgcattgc atgacacgcc tgcgcattac gccttacgat       120
     gaaagcaaag cggatgctca ggctttaaga aagcttgacg gcgtattggg ggtcgttgaa       180
     gctgaaacct tacaaattat cctcggcaca ggagttgtca atcatgttac agctgctttc       240
     tcaaagctcg tgtcagcaga agaaggtgcc gatgtcaaag aagcagcggc caaaaagaaa       300
     gccgatatca atcggaaaaa tgccactcct tttaaacttt tcttacgtaa aattgccagc       360
     atttttatcc ctcttattcc cgctctagtc gcttccggtt taattactgg gattaccaaa       420
     gcaattattc aagcaggctg gctctctgca gactcacaaa ttgcgattat cctgacagtc       480
     atcggatcag ggctgttcac ttatctcggc attctcgtcg gtattaacgc ttcgaaagaa       540
     tttggcggga cacccgcact tggggctttg gccgggatct tgattatcaa tccggagatc       600
     gcaaaaatca gtttatttgg agaagagctt ctcccgggca ggggaggtct gatcggcgtc       660
     cttttcgcag ccatattcat tgcttacacc gaacaattta ttcgccgttt tattcctcaa       720
     tcacttgata tcattgtcac acccaccgtt tcactgttaa tcaccggaat cgtaacgtat       780
     gtcgtattta tgcctttagg cggattcatt tctgatgcta ttacatccgg cctactgtcc       840
     atcctggaca tcggcggcat cgctgcgggc tttattctgg gcgcaacctt ccttcctctc       900
     gtcgtaaccg gactgcatca aggcttgacg cctgtgcaca tggaactgat caattcaatt       960
     ggcaatgatc ctctgctccc tattttggct atgggaggtg caggacaggt aggcgcggcc      1020
     tttgccgttt tcgtgaagac gaaaaaaaca acactgagga aagcaatcgc cggcgggctt      1080
     ccatcgggac tgctcggcat tggtgaaccg cttattttcg gagtcacgct gccgcttggc      1140
     cgtccgtttt taacagcatg tttaggagct ggaatcggcg gcgcctttca agcttatttt      1200
     caagtagcca ccattgcgat tggtgtctcc ggactgccgc tatcttttct agtcctgcct      1260
     tcgcaaatca tcctgtatat cgttgggctc tttatttcct acgcggccgg ttttttattg      1320
     acctatgcat tcggatataa agatgaaatg gcttctcagt tcgattaa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page