(data stored in ACNUC7421 zone)

EMBL: AL009126.MURQ

AL009126.MURQ        Location/Qualifiers
FT   CDS_pept        complement(192051..192965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /locus_tag="BSU_01700"
FT                   /old_locus_tag="BSU01700"
FT                   /product="D-lactyl ether N-acetylmuramic-6-phosphate acid
FT                   etherase"
FT                   /function="16.13: Shape"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="4.2.1.126"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 15983044, 20400549, 16452451;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01700"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11946"
FT                   /db_xref="GOA:Q45582"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="SubtiList:BG11570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45582"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11946.1"
FT                   /translation="MSEPLNLHRLTTESRNSQTVEIHKANTLGILKMINNEDMKVAAAV
FT                   QEVLPDIKTAVDCAYESFQNGGRLIYTGAGTSGRLGVMDAVECPPTYSVSPDQVIGIMA
FT                   GGPEAFLQAAEGIEDSEEAGAEDLRNIQLTSNDTVIAIAASGRTPYAAGALRYARKVGA
FT                   HTIALTCNENSAISKDADHSIEVVVGPEAITGSTRMKAATAHKMILNMISTAVMVKIGK
FT                   VYENLMVDVNVSNKKLKERAISIIQSLTNASYDTARYTLEQADHHVKTAIVMLKTSTDQ
FT                   KQAQTLLDEANGFIDKAIEHYHP"
     atgtcagaac cattaaacct tcaccgtctt acaacggaat cacgcaatag tcaaacagtt        60
     gaaatccaca aagcaaacac tctcggcatc cttaaaatga tcaacaacga agatatgaaa       120
     gtcgctgcag ccgttcagga ggttctcccc gacatcaaaa cagctgtaga ctgcgcatat       180
     gaatcgtttc aaaatggagg ccggctcata tatacaggcg ccggcacaag cggcagactc       240
     ggcgtcatgg atgctgttga atgtcctccc acctacagcg taagcccaga tcaggtcatc       300
     ggaatcatgg ctggaggccc cgaagccttt ttacaggcag cagagggcat tgaagacagt       360
     gaagaagcag gagctgaaga tttaagaaac atacagctca cttcaaatga caccgtcatt       420
     gccatcgcag caagcggccg cacaccctac gccgcaggcg ccctaagata cgcccgtaaa       480
     gtcggagcac acaccatcgc ccttacttgc aatgaaaatt ccgccatcag caaggatgcg       540
     gatcacagca ttgaggttgt cgtcggacct gaggccatta caggatcaac acgtatgaaa       600
     gccgcaaccg ctcataaaat gattctaaac atgatatcta ccgctgtaat ggtcaaaatc       660
     ggcaaggttt acgaaaactt gatggtagac gtcaacgtca gcaacaaaaa actaaaagaa       720
     cgcgccatca gcatcatcca aagccttaca aacgcttcat acgacacagc cagatacact       780
     ctggaacaag ccgatcatca cgtcaaaaca gcaatcgtca tgctcaaaac aagcacagat       840
     cagaaacaag cacagacatt actcgatgaa gcaaacggtt tcattgacaa agcaatcgaa       900
     cattaccatc catga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page