(data stored in ACNUC7421 zone)

EMBL: AL009126.NADE

AL009126.NADE        Location/Qualifiers
FT   CDS_pept        338288..339106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BSU_03130"
FT                   /old_locus_tag="BSU03130"
FT                   /product="ammonium-dependent NAD+ synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="6.3.1.5"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7890752, 9271869, 12682299,
FT                   19204287; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03130"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12107"
FT                   /db_xref="GOA:P08164"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="PDB:1EE1"
FT                   /db_xref="PDB:1FYD"
FT                   /db_xref="PDB:1IFX"
FT                   /db_xref="PDB:1IH8"
FT                   /db_xref="PDB:1KQP"
FT                   /db_xref="PDB:1NSY"
FT                   /db_xref="PDB:2NSY"
FT                   /db_xref="SubtiList:BG10694"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08164"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7890752, 9271869, 12682299, 19204287"
FT                   /protein_id="CAB12107.1"
FT                   /translation="MSMQEKIMRELHVKPSIDPKQEIEDRVNFLKQYVKKTGAKGFVLG
FT                   ISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPHGTQQDEDDAQLALKFIKPDKSW
FT                   KFDIKSTVSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAE
FT                   AVTGFFTKYGDGGADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLLDEKPQQSDE
FT                   TELGISYDEIDDYLEGKEVSAKVSEALEKRYSMTEHKRQVPASMFDDWWK"
     atgagcatgc aggaaaagat tatgcgtgag ttacatgtga agccctcaat tgatccaaag        60
     caagaaattg aggaccgagt caatttttta aaacaatatg taaagaaaac cggtgctaaa       120
     ggctttgtat tgggaatcag cgggggccag gattcaacac ttgcgggaag actcgctcag       180
     cttgcggtgg agagcattcg cgaggagggc ggagacgctc aatttatcgc ggtccgtctt       240
     ccgcatggca cacagcagga tgaagacgat gcccagcttg ctttgaagtt tattaagccg       300
     gataaatcat ggaagtttga tattaaatcg acagtcagcg ctttttctga tcagtatcag       360
     caggaaacag gcgatcagct gacggacttt aataaaggaa acgtaaaagc aagaacaaga       420
     atgatcgcgc aatacgcgat cggcggccag gaaggtcttc ttgtgttagg aacagaccat       480
     gctgctgaag cagtgactgg tttctttacg aagtacggtg acggcggagc agacctcctg       540
     ccgctgacag gcttgacgaa gcgccaggga agaaccttgc tgaaagagct gggtgcaccg       600
     gaacgcttat acttaaaaga accgactgcc gatctgctcg acgaaaaacc gcagcagtcg       660
     gatgaaacag agcttggcat ttcctacgac gagattgacg attatctcga aggaaaagaa       720
     gtatcagcga aagtatcaga agcgctggaa aaacgctaca gcatgactga acataaacgc       780
     caggttccgg cgtctatgtt tgatgactgg tggaaataa                              819
//

If you have problems or comments...

PBIL Back to PBIL home page