(data stored in ACNUC7421 zone)

EMBL: AL009126.NAGZ

AL009126.NAGZ        Location/Qualifiers
FT   CDS_pept        complement(186452..188380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagZ"
FT                   /locus_tag="BSU_01660"
FT                   /old_locus_tag="BSU01660"
FT                   /product="N-acetylglucosaminidase lipoprotein"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.2.1.52"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8063094, 20400549, 20826810,
FT                   23177201, 26963691; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11942"
FT                   /db_xref="GOA:P40406"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="PDB:3BMX"
FT                   /db_xref="PDB:3LK6"
FT                   /db_xref="PDB:3NVD"
FT                   /db_xref="PDB:4GYJ"
FT                   /db_xref="PDB:4GYK"
FT                   /db_xref="SubtiList:BG10832"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40406"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8063094, 20400549, 20826810, 23177201, 26963691"
FT                   /protein_id="CAB11942.1"
FT                   /translation="MRPVFPLILSAVLFLSCFFGARQTEASASKRAIDANQIVNRMSLD
FT                   EKLGQMLMPDFRNWQKEGESSPQALTKMNDEVASLVKKYQFGGIILFAENVKTTKQTVQ
FT                   LTDDYQKASPKIPLMLSIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKE
FT                   LSALGINTDFSPVVDINNNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKH
FT                   FPGHGDTDVDSHYGLPLVSHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTY
FT                   KSKLDGSDILVPATLSKKVMTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVK
FT                   AGVDIALMPASVTSLKEEQKFARVIQALKEAVKNGDIPEQQINNSVERIISLKIKRGMY
FT                   PARNSDSTKEKIAKAKKIVGSKQHLKAEKKLAEKAVTVLKNEQHTLPFKPKKGSRILIV
FT                   APYEEQTASIEQTIHDLIKRKKIKPVSLSKMNFASQVFKTEHEKQVKEADYIITGSYVV
FT                   KNDPVVNDGVIDDTISDSSKWATVFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKA
FT                   LIAVYGFKGYANGRYLQPNIPAGVMAIFGQAKPKGTLPVDIPSVTKPGNTLYPLGYGLN
FT                   IKTGRPL"
     atgagacctg tctttccgct tatcctttca gccgttctct ttctttcatg ctttttcggg        60
     gccagacaga cagaagcctc tgcatccaaa cgtgcaatcg atgccaatca gattgtcaat       120
     cgtatgtcgt tagatgaaaa actcggccag atgctgatgc ctgattttag aaattggcaa       180
     aaggaaggcg agtcctctcc gcaagccctt acaaaaatga atgatgaagt cgccagcctc       240
     gtcaagaaat atcaattcgg aggcatcatc ctttttgcag aaaatgtaaa aacaacaaaa       300
     caaactgtcc aactgacaga cgattaccaa aaggcaagtc caaaaatccc gctcatgctg       360
     agtattgatc aggaaggcgg cattgtaacg aggttagggg agggcactaa tttcccaggg       420
     aatatggcgc tgggcgcagc cagaagcaga atcaatgcgt atcagaccgg cagcatcatc       480
     ggaaaagagc tctctgcctt aggcatcaat acagatttca gccctgtcgt ggacattaac       540
     aataatcctg ataatcctgt aatcggcgta cggtcattca gctccaatcg agaactgaca       600
     tcacgcctcg gtttatatac gatgaaaggg ttgcagcggc aggatatcgc gtctgccctc       660
     aaacatttcc cgggacatgg agacacggac gttgacagcc attatggact gccgctcgtt       720
     tcccatggcc aagaacggct tcgtgaggtc gagctttatc cttttcaaaa agcaattgat       780
     gctggtgctg atatggtgat gacagcccat gttcagtttc ccgcctttga tgacaccact       840
     tacaaaagca aactcgatgg atcggacatt ctggttccag ctacactttc aaaaaaagtg       900
     atgacaggtc ttcttcgtca ggaaatgggc tttaatgggg tcatcgttac cgatgcgctc       960
     aatatgaagg caatcgcaga tcatttcgga caggaagagg ctgtggtcat ggccgtaaaa      1020
     gctggtgtcg atattgcatt aatgccagcc tcagtcactt cattgaaaga agaacagaaa      1080
     ttcgcacgtg ttattcaagc tttgaaagaa gccgtgaaaa acggggatat tcctgaacaa      1140
     caaatcaaca attcagttga aagaatcatt tccctgaaaa taaaacgcgg catgtatcca      1200
     gcgcgaaaca gcgacagtac aaaagaaaaa atagccaaag ccaaaaaaat cgtaggaagc      1260
     aagcagcacc tgaaagcaga gaaaaaatta gctgaaaaag cagtaactgt attaaaaaat      1320
     gaacagcaca ctttgccgtt caagcctaaa aaaggcagcc gaatcttaat tgtggcacct      1380
     tacgaagaac aaactgcttc aatcgaacaa accattcacg atctcatcaa gcgaaagaaa      1440
     atcaaacccg tatccctcag caaaatgaac tttgccagcc aagtatttaa gaccgagcat      1500
     gaaaaacaag taaaagaggc tgattatatc attaccggct cctatgtcgt caaaaatgac      1560
     cctgtcgtca acgacggtgt catcgacgac acaatatcag attcaagcaa atgggccacc      1620
     gtgtttccga gagctgtcat gaaagccgca ctgcagcaca acaaaccatt tgtcttaatg      1680
     agcctgcgca acccctatga cgcagccaat ttcgaagaag caaaagcact gattgcagtc      1740
     tatggcttta aaggatacgc aaatggccgt tatcttcaac ctaatattcc ggccggagtg      1800
     atggcgatat tcggccaggc aaaacctaaa ggcacacttc cagttgacat tccgtcagtc      1860
     acgaaaccag ggaacaccct ttacccactt ggctacggat taaatatcaa aacgggaaga      1920
     ccgctttaa                                                              1929
//

If you have problems or comments...

PBIL Back to PBIL home page