(data stored in SCRATCH zone)

EMBL: AL009126.NASB

AL009126.NASB        Location/Qualifiers
FT   CDS_pept        complement(360442..362757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasB"
FT                   /locus_tag="BSU_03320"
FT                   /old_locus_tag="BSU03320"
FT                   /product="assimilatory nitrate reductase (electron transfer
FT                   subunit NasB)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.7.1.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7836289, 8799114, 9765565,
FT                   10940050, 10972836, 15028686, 24122235; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03320"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12126"
FT                   /db_xref="GOA:P42433"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="SubtiList:BG11094"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42433"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7836289, 8799114, 9765565, 10940050, 10972836,
FT                   15028686, 24122235"
FT                   /protein_id="CAB12126.2"
FT                   /translation="MKKQRLVLAGNGMAGIRCIEEVLKLNRHMFEIVIFGSEPHPNYNR
FT                   ILLSSVLQGEASLDDITLNSKDWYDKHGITLYTGETVIQIDTDQQQVITDRKRTLSYDK
FT                   LIVATGSSPHILPIPGADKKGVYGFRTIEDCQALMNMAQHFQKAAVIGAGLLGLEAAVG
FT                   LQHLGMDVSVIHHSAGIMQKQLDQTAARLLQTELEQKGLTFLLEKDTVSISGATKADRI
FT                   HFKDGSSLKADLIVMAAGVKPNIELAVSAGIKVNRGIIVNDFMQTSEPNIYAVGECAEH
FT                   NGTVYGLVAPLYEQGKALASHICGVPCEEYQGSAPSAALKIAGIDVWSAGKIQEDERTT
FT                   SIKIYDEQAGVYKKALFVDDKLAGVILFGDTRDKQRLLDSLLKQRDISIAKKQIIEPET
FT                   SGPLFESMPSSETICQCNTVTKGAIEDAVHTNSLTTVEEVKHCTKATGSCGGCKPLVED
FT                   LLRYMTNSEYTKPASTPSFCSCTDFTEDDIIAELQRRPFTNPAEVMNQLDWKTKNGCST
FT                   CVPAIQYYLEMLYPGFVQPEPATEETCILIPQMYGGRTNAEQLRTIANIIEAYSIPDVS
FT                   ITHGQRLKLSGIKPADLPNMKKDLKMPVYTNEHRHALQSIKACTCGQNRSIQQLAAQIE
FT                   RQLEMLPLPAPISISLSCETDCTEAALQDVGAIRTQAGWDIHIGGVRGTHARSGALFCV
FT                   TENEDSTAGMIKGLIQYYRETAHYLEGVHQWIDRLGIVHIREVLFEEDLRAQLLESLQT
FT                   DLSLIQNPTVETGAYKKG"
     atgaagaaac aaagattagt gttagcggga aacggcatgg ccggaatccg ctgtattgaa        60
     gaagtattaa agctgaatcg ccacatgttt gagattgtca ttttcggaag cgagccgcat       120
     cccaattaca atcgcattct cttatcctct gtattgcagg gtgaagcgtc actcgatgat       180
     attacactga acagcaagga ttggtacgac aagcacggga tcacgcttta cacaggcgaa       240
     acggttattc agattgatac agatcagcag caggtcatca cagatcggaa acgcactctg       300
     tcgtatgaca aattaatagt ggcaacaggc tcctcccctc atattctccc tatccccggg       360
     gcagacaaaa aaggtgtcta tggatttcgg acaatagaag actgccaagc gctgatgaac       420
     atggcccagc actttcaaaa ggctgcggta atcggagccg gcttattagg actggaagct       480
     gcagtaggtt tacagcatct cggtatggat gtcagcgtca ttcaccactc cgccggcatt       540
     atgcaaaaac agctcgatca aacagcggcg cggctgctgc aaacagagct ggaacaaaaa       600
     ggcctaacct ttcttttgga gaaagacacc gtctccattt ccggcgccac gaaggcagac       660
     cgaatccatt ttaaagatgg ctcttcatta aaagcagact tgattgtgat ggcggccggc       720
     gtcaaaccga atattgaatt ggctgtatcc gctggaatca aagtgaaccg cgggatcatc       780
     gtgaatgact tcatgcagac aagcgaaccg aatatctacg ccgttggtga atgcgctgag       840
     cataacggaa cggtgtacgg attggtggct ccgctttatg agcagggaaa agcgctcgcc       900
     agtcatattt gcggcgttcc atgtgaggaa tatcaaggct cagcaccatc tgcggcgtta       960
     aaaatagctg gaatcgatgt gtggtcagca ggaaagatcc aagaggatga acgcacgacg      1020
     agcatcaaaa tctacgacga acaagcaggc gtttataaaa aagcgctttt tgtagatgac      1080
     aaactggccg gcgttatttt attcggagac acccgtgaca agcagcggct tctcgacagc      1140
     ctgcttaaac aacgagacat ctccattgcc aaaaaacaga tcatcgaacc ggagacaagc      1200
     ggccctttat ttgaatccat gccttccagt gaaacgattt gccaatgcaa cacagtgacg      1260
     aaaggcgcga ttgaagacgc ggtgcacacg aatagcttaa caactgttga ggaagtcaag      1320
     cactgcacca aagccactgg gtcctgcgga ggatgcaaac cgctcgttga agaccttttg      1380
     agatacatga ccaacagcga atatacgaag cccgccagca caccttcgtt ttgcagctgt      1440
     actgatttta cagaagacga catcatcgct gagcttcagc gcaggccatt cactaatccg      1500
     gcagaagtga tgaaccagct tgactggaaa acaaaaaacg gatgcagtac ttgtgttcct      1560
     gcgattcaat actatctgga aatgctgtac cctgggtttg tccagcctga gccagccact      1620
     gaagagacat gcatcctgat tccgcaaatg tacggcgggc ggacaaacgc ggagcagcta      1680
     agaaccatcg ccaacatcat tgaggcatac agcattcccg acgtatccat cactcacggc      1740
     caaaggctga agctttccgg gatcaagcct gcggatctcc cgaacatgaa aaaagacctg      1800
     aaaatgcccg tttacactaa tgaacaccga cacgcgctgc aaagcatcaa agcatgtaca      1860
     tgcgggcaaa atcgatcgat tcagcagctg gcagcccaaa tcgaaagaca acttgagatg      1920
     cttcccttac ccgctcccat ttctatcagc ttatcatgtg aaacagactg caccgaggcc      1980
     gccctgcaag atgtcggcgc aattcggaca caagctggct gggacattca catcggcggc      2040
     gtccggggaa ctcatgcccg ttcaggagct ttgttttgcg tgactgagaa cgaagacagc      2100
     actgccggca tgatcaaagg actgatccag tattatcggg aaacggctca ttacttagaa      2160
     ggtgttcatc agtggataga ccgtctcggg atcgttcata tcagagaagt gctattcgaa      2220
     gaagacctaa gggcacagct gctggaaagc ctccaaacag atctgtcact gattcaaaac      2280
     ccgactgtag agacgggcgc atataagaaa ggatga                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page