(data stored in SCRATCH zone)

EMBL: AL009126.NASD

AL009126.NASD        Location/Qualifiers
FT   CDS_pept        complement(355764..358181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasD"
FT                   /locus_tag="BSU_03300"
FT                   /old_locus_tag="BSU03300"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.7.1.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10972836, 15028686, 9765565,
FT                   16428414, 22103536; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03300"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12124"
FT                   /db_xref="GOA:P42435"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="SubtiList:BG11096"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42435"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10972836, 15028686, 9765565, 16428414, 22103536"
FT                   /protein_id="CAB12124.1"
FT                   /translation="MGKKQLVLVGNGMAGVRAIEEILSVAKDEFQITIFGAEPHPNYNR
FT                   ILLSKVLQGDTDIKDITLNDWDWYEENNIQLYTNETVIKVDTENKTVITDADRIQPYDE
FT                   LILATGSVPFILPIPGADKKGVTAFRDIKDTDTMLAASKQYKKAAVIGGGLLGLEAARG
FT                   LLNLGMDVSVIHLAPFLMERQLDATAGRLLQNELEKQGMTFLLEKQTEEIVGDDRVEGL
FT                   RFKDGTSIEADLVVMAVGIRPNTTLGAESGIPVNRGIIVNDYMQTEIPHIYAVGECAEH
FT                   RGIAYGLVAPLYEQAKVLAKHMCGIETKPYEGSVLSTQLKVSGVEVFSAGDFNESEEKK
FT                   AIKVFDEQDGIYKKIVLRGNQIVGAVLFGDSSEGNRLFSMIQKEADISETSKISILQPL
FT                   SQEAGTSITAAMSDDEIICGCNGVSKGAIIQAIQEKGCSSTDEIKACTGASRSCGGCKP
FT                   LVEEILQHTLGSDFDASAQKEAICGCTTLSRDEVVEEIKAKGLSHTREVMNVLGWKTPE
FT                   GCSKCRPALNYYLGMINPTKYEDDRTSRFVNERMHANIQKDGTYSVVPRMYGGVTNSTD
FT                   LRKIADVVDKYEIPLVKMTGGQRIDLIGVKKEDLPKVWEDLDMPSGYAYGKTLRTVKTC
FT                   VGEQFCRFGTQDSMALGIALEKKFEGLNTPHKVKMAVSACPRNCAESGIKDLGVVGIDG
FT                   GWELYVGGNGGTHLRAGDLLMKVKTNEEVLEYAGAYLQYYRETANYLERTSAWLERVGL
FT                   SHVQSVLNDPEKRQELNGRMNETLSVHKDPWKDFLEDKQTSKELFENVVTTS"
     atgggaaaaa aacagctagt tcttgttggt aatggaatgg ccggggtaag ggccattgaa        60
     gagatactga gtgttgctaa agacgagttt cagatcacaa ttttcggtgc cgaaccgcat       120
     cccaattaca accgaatcct tttgtcaaaa gtgcttcaag gcgatacaga tattaaagat       180
     attacgttaa acgattggga ctggtacgaa gaaaacaaca ttcaattgta tacaaatgaa       240
     acagtcatca aagtggacac ggaaaacaaa acagtcatca cagatgcaga cagaatccag       300
     ccttacgatg aattgatcct ggcgacagga tcggtccctt ttatccttcc gattccgggc       360
     gcagacaaaa aaggcgtcac agctttccgg gacataaaag atacagacac aatgctcgcc       420
     gcgtcaaaac aatataaaaa agctgccgtc atcggcggag gactacttgg tttggaagca       480
     gctcgcggac tgctgaatct cggcatggac gtgtccgtca tccaccttgc cccattcctg       540
     atggagcgcc agcttgatgc aacggcagga cgcctgctgc aaaacgagtt agaaaaacaa       600
     ggtatgacct ttttacttga aaagcaaaca gaagaaattg tcggtgacga ccgtgtcgaa       660
     ggcctccgat tcaaggatgg cacaagcatt gaagctgatt tagtcgtcat ggctgtcggc       720
     atccgcccaa atacaacgct cggggccgag agcggcattc cggttaaccg cggcatcatc       780
     gtcaacgatt atatgcagac tgaaatcccg cacatttacg cggtcggcga atgtgccgag       840
     caccgaggaa tcgcctacgg gcttgtggcg ccgctgtatg aacaggcaaa agtgctggca       900
     aagcatatgt gcggcatcga aacaaaaccg tatgagggct ccgttctctc cacacagtta       960
     aaggtatcag gcgtcgaggt cttctctgcc ggtgacttta acgaatcaga ggagaaaaaa      1020
     gcgattaaag tcttcgatga gcaggacggc atctataaaa aaattgtcct gagaggcaat      1080
     caaattgtcg gtgctgtttt attcggcgac agcagcgaag gcaatcgcct gttttctatg      1140
     attcaaaaag aagccgatat ctctgaaacc tctaaaatat caatcttaca gcccctcagc      1200
     caggaagcag gcacaagcat aaccgcagcg atgagcgacg atgaaatcat ctgcggctgt      1260
     aacggcgtgt caaaaggtgc gattattcaa gccatacagg aaaagggctg ctcgtcaacg      1320
     gacgaaatca aagcatgcac cggcgcatcc cgctcatgcg gaggctgtaa gccgctcgta      1380
     gaagaaatcc tccagcatac gctcggatca gactttgatg cgtcagcgca aaaagaagcc      1440
     atttgcggct gcaccacatt gtcgagagat gaagtcgtag aagaaatcaa agccaaaggg      1500
     ctgtcacata caagagaagt catgaatgtg ctcggctgga aaacgccaga aggctgttct      1560
     aaatgccgac ccgctctgaa ctactactta ggcatgatca atccaaccaa atacgaggat      1620
     gaccggacat cccgctttgt taatgaacga atgcacgcca atattcaaaa agacggaaca      1680
     tactcagtcg ttcctcggat gtacggcggc gtgaccaact ccacagattt gcgcaagatc      1740
     gccgatgtcg ttgacaaata tgagatcccg ctcgtgaaaa tgacaggcgg ccagcgaatt      1800
     gatcttatcg gcgtgaaaaa agaagacctt ccgaaggtat gggaagatct tgatatgcca      1860
     tcgggctacg cgtacggaaa aacgctccgc acagtgaaaa catgtgtagg cgagcaattc      1920
     tgccgcttcg gcacacaaga ctccatggca ctgggcattg cgcttgagaa aaaattcgaa      1980
     gggctgaaca cgcctcacaa agtcaaaatg gccgtgtctg cctgcccgcg aaactgtgcg      2040
     gaatccggca ttaaggacct tggcgttgtc ggcatcgacg gaggctggga gctttatgtc      2100
     ggcggaaacg gcggaaccca tttgcgtgcc ggcgatttgc tgatgaaggt gaaaacaaat      2160
     gaagaagtct tagaatacgc gggcgcttac ctgcaatatt acagggaaac cgcaaactat      2220
     ctggagcgta cgtccgcatg gcttgagcgc gtcggtttat cccatgtcca atccgtgtta      2280
     aacgatccgg aaaagcggca ggagctgaac ggccgaatga atgaaacact ctctgtccac      2340
     aaggatccgt ggaaagactt tttagaggat aaacaaacct ctaaagaatt atttgaaaat      2400
     gtcgtgacca catcataa                                                    2418
//

If you have problems or comments...

PBIL Back to PBIL home page