(data stored in SCRATCH zone)

EMBL: AL009126.NASE

AL009126.NASE        Location/Qualifiers
FT   CDS_pept        complement(355412..355732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasE"
FT                   /locus_tag="BSU_03290"
FT                   /old_locus_tag="BSU03290"
FT                   /product="assimilatory nitrite reductase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.7.1.4"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10217486, 15028686, 9765565,
FT                   22103536; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12123"
FT                   /db_xref="GOA:P42436"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="SubtiList:BG11097"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42436"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10217486, 15028686, 9765565, 22103536"
FT                   /protein_id="CAB12123.1"
FT                   /translation="MVNKDVTKVCIGKIEELPEQLGKTVYIEDKELAVFKLSDGSIRAI
FT                   ENRCPHKGGVLAEGIVSGQYVFCPMHDWKISLEDGIVQEPDHGCVKTYETLIEGEHVYL
FT                   VY"
     atggtaaaca aagacgtaac aaaagtatgt atcggaaaaa ttgaagaatt gcctgaacaa        60
     ttaggcaaaa cagtgtatat tgaagataag gagctcgcgg ttttcaagct ttcagacgga       120
     agcatccgcg ccattgaaaa ccgctgtccg cataagggcg gcgtcctggc agaaggcatc       180
     gtcagcggtc aatatgtttt ctgcccgatg cacgactgga aaatttcctt agaagacgga       240
     atcgtccaag aacctgacca cggatgcgtc aaaacatatg aaacgctgat cgaaggagaa       300
     catgtttatc tcgtatattg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page