(data stored in ACNUC7421 zone)

EMBL: AL009126.NASF

AL009126.NASF        Location/Qualifiers
FT   CDS_pept        complement(353900..355351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nasF"
FT                   /locus_tag="BSU_03280"
FT                   /old_locus_tag="BSU03280"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.10: Respire"
FT                   /EC_number="2.1.1.107"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9765565, 10217486, 15028686;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03280"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12122"
FT                   /db_xref="GOA:P42437"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="SubtiList:BG11098"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42437"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9765565, 10217486, 15028686"
FT                   /protein_id="CAB12122.1"
FT                   /translation="MIMKNGIVYFVGAGPGDPGLLTIKGKQALKEADVILYDRLANPKL
FT                   LEFASPDCQFIYCGKLPNRHFMKQKEINALLVEKALNGLTVVRLKGGDPSVFGRVGEEA
FT                   DALHEHGIRYEMVPGITSGIAAPLYAGIPVTHRDFASSFAMITAHDKSLKGTPNLDWEG
FT                   LARSVQTLVFYMGVKNLSYICQQLISYGKSPSVPVIVIQWGTWGRQRSVKGTLENIQQK
FT                   VQEHQITNPAIIVIGDIVNFQTHSWFESKPLIGRHLMVVTHGEDEDPLADKLRDSGADL
FT                   IEWPKWRTENMPVNEEILRKIGTFEDVFFTSRRAVCEFFRALASQKIDIRQLTAKLSAA
FT                   SEQAKTELEKRGFLVTAIQPDSEKRLVVGSRHAVENMQKHESCSFYITHENVIDDRFTH
FT                   MIQRTISESPLHMVICPNKLSVQQLINGGEQIGILPEPSASRPPIVCIGDDSAAGIYGF
FT                   TAVQEQDELLAFIHNQHAEKKLLHT"
     atgatcatga agaacggaat cgtatatttc gtgggagccg gacccggcga cccaggcctg        60
     ctcaccatca aaggaaaaca ggcgctcaag gaagcagatg tgattttata tgaccggctc       120
     gccaacccga agctgctcga atttgcatca ccggactgcc agtttattta ttgcggaaaa       180
     ctgccaaacc gccattttat gaaacaaaaa gaaattaacg ccctgctggt tgaaaaagca       240
     ttaaatgggt taaccgtcgt tcgcttgaag ggcggagatc cgagcgtatt cggcagagtc       300
     ggcgaggaag cagatgctct tcatgagcac ggcattcgct atgaaatggt gccgggaatc       360
     acctctggaa ttgcagcgcc gctatatgcg ggcatccccg tcacgcatcg ggattttgca       420
     tcgtcttttg ccatgattac agcgcatgat aaatcattaa aaggcacgcc gaaccttgac       480
     tgggaagggc tggcccgaag cgttcaaacc cttgtttttt acatgggtgt caagaacttg       540
     tcttatattt gccagcagct tatttcatac gggaaatcgc cttctgtccc tgtcattgtc       600
     atccaatggg gaacgtgggg ccgccagcgg agtgtgaaag gaacacttga gaacattcag       660
     caaaaagtgc aggaacacca gattacaaac cctgcgatta tcgtcatcgg agacatcgtc       720
     aactttcaaa cacacagctg gtttgaaagc aaaccgctca tcggacggca tttgatggtt       780
     gtgactcatg gcgaagatga agacccgctt gcagacaagc tgcgcgattc cggcgccgat       840
     ctcatcgagt ggccgaaatg gcggaccgaa aacatgcctg tcaatgaaga aattcttcga       900
     aagattggca cctttgaaga cgtttttttc acatcgcgcc gggcggtttg tgaatttttc       960
     agagcactgg cttctcagaa aatcgacatc cgccagctga cagccaaact gagtgcagca      1020
     tctgagcaag caaagacaga gcttgagaaa cggggctttc ttgtcaccgc cattcagcct      1080
     gattcagaga aacgtcttgt tgtcgggagc cgccatgcag tggaaaacat gcaaaagcat      1140
     gaatcctgtt cgttttatat cactcatgaa aacgtcatag atgaccggtt cacccacatg      1200
     attcagcgta ccatcagtga atccccgctg cacatggtca tttgcccaaa caagctgtcc      1260
     gttcagcaat tgatcaatgg tggcgaacaa attggcattt tgccggaacc gtcagcaagc      1320
     cgccctccta tcgtctgcat aggcgatgac tcagctgccg gcatttatgg attcacagcc      1380
     gtacaagaac aggatgaatt gctagctttc atccacaatc aacatgcaga gaaaaaactc      1440
     cttcacacct ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page