(data stored in ACNUC7421 zone)

EMBL: AL009126.NATA

AL009126.NATA        Location/Qualifiers
FT   CDS_pept        296429..297169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA"
FT                   /locus_tag="BSU_02750"
FT                   /old_locus_tag="BSU02750"
FT                   /product="Na+ ABC efflux transporter (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10356997, 17322186; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12069"
FT                   /db_xref="GOA:P46903"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11338"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46903"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10356997, 17322186"
FT                   /protein_id="CAB12069.1"
FT                   /translation="MITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKT
FT                   TMLRMIASLLEPSQGVITVDGFDTVKQPAEVKQRIGVLFGGETGLYDRMTAKENLQYFG
FT                   RLYGLNRHEIKARIEDLSKRFGMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDE
FT                   PTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALE
FT                   SLYESERSEDLNYIFMSKLVRGIS"
     atgattacac tgaccgattg cagccgcagg tttcaggata agaaaaaagt agtcaaagcg        60
     gtgcgagatg taagcttaac aattgaaaaa ggagaagtcg tcggcattct cggagaaaac       120
     ggtgccggca aaacgacgat gctgagaatg attgcttcct tgcttgaacc atcacagggt       180
     gtaatcacag tagacggctt tgacacggtc aagcagccgg ctgaggtcaa acaaagaatc       240
     ggtgtcttat tcggaggaga aaccgggctt tacgacagga tgaccgctaa agaaaatctc       300
     caatacttcg gcaggctgta tgggctgaac cgccacgaga tcaaagcaag aatagaagat       360
     ttatcgaaac ggttcggcat gcgcgattat atgaaccgga gagtgggcgg gttttcgaaa       420
     ggcatgaggc agaaagtcgc cattgccaga gcgctgattc acgatccgga catcatttta       480
     tttgatgagc cgacaactgg gcttgatatt acgtcaagca acatcttccg cgaatttata       540
     cagcagctga aaagagaaca aaaaacgatt cttttctcca gccacattat ggaggaagtg       600
     caggcgctct gtgacagtgt catcatgatt cacagcggag aggtgattta ccgaggggcg       660
     cttgaatcac tatacgagag cgagcgcagt gaggatttga attacatctt tatgtctaag       720
     cttgtcaggg ggatttctta a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page