(data stored in ACNUC7421 zone)

EMBL: AL009126.NATK

AL009126.NATK        Location/Qualifiers
FT   CDS_pept        complement(294615..295571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natK"
FT                   /locus_tag="BSU_02730"
FT                   /old_locus_tag="BSU02730"
FT                   /product="two-component sensor histidine kinase [NatR]"
FT                   /function="16.12: Sense"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11717295, 17322186; Product
FT                   type rc: receptor"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02730"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12067"
FT                   /db_xref="GOA:P70954"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="SubtiList:BG11997"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70954"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11717295, 17322186"
FT                   /protein_id="CAB12067.1"
FT                   /translation="MITLFQCLYLILFSFICYQGAAAFSHSTAASWLAAALGAAAAGLY
FT                   IWNTKRVWKHCSSGLCAWIAVIQVMSVGVVLIGTDIMPVLCVIAIFAGCEGLRIGQSAL
FT                   QARLSDQIDKLTQAEQHANQMLIDVRSRNHDTMKHITAIKSAQPKADTQAYIQNWADQY
FT                   SQYDRFLKGENAYVAGVLYDFLEKARASNVSVSLHMHTPLSSLPFSPADQVSLVGNILE
FT                   NALDSAAEAREKAEIKLETSLRSGLYVLTCENSTPGMDPKVLDTIYQSFGRSTKNGAHE
FT                   GMGTYIIQKLVKGAFGRLDFTYRHPIFRLEIKIPFQK"
     gtgattaccc tttttcaatg tctttatctg attttattta gtttcatatg ttatcaggga        60
     gctgctgctt tttcacacag cacagccgcc tcttggctcg ccgctgcttt aggcgcagct       120
     gctgcaggat tgtacatttg gaatacgaag cgggtgtgga aacactgttc ctcagggctt       180
     tgtgcgtgga ttgcggtgat tcaagtgatg tcggtgggag tggtgttgat tggcacagac       240
     atcatgccgg tattatgtgt aatcgcgata tttgcagggt gtgaagggct ccgtatcgga       300
     cagtctgctt tgcaggcaag gctttctgat caaattgata agctgactca agctgaacag       360
     cacgccaatc aaatgctgat tgatgtcaga agccggaatc atgacacaat gaaacatatc       420
     actgcaatca aatcagctca gcccaaggca gatacacaag catatattca aaactgggcg       480
     gatcaataca gccaatatga ccgttttttg aaaggagaga acgcgtacgt tgcaggggtg       540
     ctttatgatt ttttagaaaa agcccgcgcc tcgaatgtga gtgtttcgct gcatatgcat       600
     acaccgcttt cttcccttcc gttttcgcct gctgatcagg tcagcttggt cggcaacata       660
     ttagaaaatg cgctcgacag cgcggcggag gcccgagaaa aagcagagat taaactggag       720
     acttcactgc gcagcgggct ttatgtactg acttgtgaaa acagcactcc cgggatggac       780
     ccaaaagtgc tcgatacaat ttatcaatcg tttggccgct caacgaaaaa cggcgctcat       840
     gaaggcatgg gcacatatat cattcaaaaa ctggtgaagg gcgcttttgg caggctggat       900
     tttacctacc gccaccccat cttccggtta gaaatcaaaa ttccgtttca gaaataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page