(data stored in SCRATCH zone)

EMBL: AL009126.NDHF

AL009126.NDHF        Location/Qualifiers
FT   CDS_pept        205409..206926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag="BSU_01830"
FT                   /old_locus_tag="BSU01830"
FT                   /product="putative NADH dehydrogenase; prophage 1 region"
FT                   /function="16.10: Respire"
FT                   /EC_number="1.6.-.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 10658656, 15849754,
FT                   16850406, 17015645, 6816592, 7565865; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU01830"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11959"
FT                   /db_xref="GOA:P39755"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="SubtiList:BG10949"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39755"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11959.1"
FT                   /translation="MLVSLSLSSLLTLFFIMLMASGISGLLFLHPRVPLSFVRIHIGIL
FT                   ALPLLVSLLILANSGVSGNVGPWHLDSLACLMTFFVLAIGFIIQRFSVRYLMGDRSYRK
FT                   YFTLFTFTTGAASMTWLSGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRLF
FT                   LLSWFSLFFAMMWLFHATGQWQLSLVVTNESLAGLGEWERTGIQLLIVLAVIIPAAQWP
FT                   FQRWLVESIVAPTPVSAIMHAGLVNAGGIILTRFSPLFHGGIASIILLLLASISVLIGT
FT                   GISLVQVDYKRQLVGSTIGQMGFMLIQCALGAYIAAIIHLILHGLFKATLFLQAGSAVG
FT                   RHEVSTRTNERTSYLWVMAGRILSLVIGVAFWLTAPGDGYHLISALILGWSLSVSWDQL
FT                   VAFGEGRIGRIAGLTVLGGAALVYFIIHHLFYKWLHTTIFQSVQPPMSAVMIVVCLLLF
FT                   GSALGTWVARHRSSVFFAVLYLWLVRLGEAKPKSVESHPDYLKQYIS"
     atgttagttt cgctgagttt gtcatcatta ttaacattat tttttattat gcttatggct        60
     tctgggatta gtggactatt gtttttacat ccgcgtgtac ccttgagttt tgttcgcatt       120
     catattggga tcttggcttt accacttttg gtttccttac tgattcttgc caatagtggt       180
     gtgagtggaa atgttggccc ttggcactta gattccttag cttgtttaat gactttcttt       240
     gttcttgcaa ttggattcat cattcagcgt ttttctgtac gttacttaat gggggatcga       300
     tcttatcgaa aatattttac gctttttact ttcacaacag gagctgcttc aatgacatgg       360
     ttaagtggtg atctccgctt gatggttcta ttttggggag caactcttgt tggtttaacc       420
     ttacttataa ggttaaacag tgcttggcaa gtggctagtg aagcagccaa aatttctgga       480
     cggttatttt tgttaagttg gttttctttg ttttttgcga tgatgtggct ttttcatgcc       540
     acaggtcaat ggcagctatc attggttgta acaaatgaaa gtttagctgg gctgggagaa       600
     tgggagagaa cagggattca gctattgatt gtactggcgg tgatcattcc tgcagctcaa       660
     tggccgttcc aaagatggtt ggttgagtct attgttgctc ccaccccagt ttctgcaatt       720
     atgcatgcag gtttagtaaa tgctggagga ataatactaa ctcgattttc acctctattt       780
     catggtggta tcgcttcgat tatcttactt ctgcttgcta gcatttctgt attgattgga       840
     actggaatta gtttagttca ggttgattat aaacgccagt tagtaggctc cacgattgga       900
     caaatggggt ttatgctcat tcagtgtgca ttaggcgcct atatagcagc cattattcac       960
     cttattttac atggtttatt caaggctacg ttgtttctac aggctggttc agcagtaggg      1020
     cgtcatgaag tatcgactcg cactaatgaa agaacatcct atttatgggt catggctggt      1080
     cggattttat ccttagttat aggtgttgct ttttggctca ctgctcctgg agacgggtat      1140
     cacttaatca gtgcgctgat cttagggtgg tcattgtccg tttcttggga tcagcttgtc      1200
     gcttttggag agggccgaat tggccggatt gccggtttaa ctgttttagg aggagcagcc      1260
     ctcgtatatt ttatcattca tcaccttttc tataagtggc tgcatacaac catttttcaa      1320
     agtgttcaac ctccaatgtc agctgtcatg attgtcgtat gtctcttact ctttggcagt      1380
     gctttaggta cgtgggttgc tcgtcatcgt tcttccgttt ttttcgcggt actctatctt      1440
     tggttagtcc gattaggtga agcaaaacca aagtcagtag agagtcaccc agactacctt      1500
     aaacaatata tttcataa                                                    1518
//

If you have problems or comments...

PBIL Back to PBIL home page