(data stored in ACNUC7421 zone)

EMBL: AL009126.NFRAB

AL009126.NFRAB       Location/Qualifiers
FT   CDS_pept        complement(438516..439265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nfrAB"
FT                   /locus_tag="BSU_03860"
FT                   /old_locus_tag="BSU03860"
FT                   /product="NADPH-FMN oxidoreductase (nitroreductase)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /EC_number="1.6.99.-"
FT                   /EC_number="1.5.1.39"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 16229462, 9836433, 20862523;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03860"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12194"
FT                   /db_xref="GOA:P94424"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:1ZCH"
FT                   /db_xref="SubtiList:BG12040"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94424"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:16229462, 9836433, 20862523"
FT                   /protein_id="CAB12194.1"
FT                   /translation="MNEVIKSLTDHRSIRSYTDEPVAQEQLDQIIEAVQSAPSSINGQQ
FT                   VTVITVQDKERKKKISELAGGQPWIDQAPVFLLFCADFNRAKIALEDLHDFKMEITNGL
FT                   ESVLVGAVDAGIALGTATAAAESLGLGTVPIGAVRGNPQELIELLELPKYVFPLSGLVI
FT                   GHPADRSAKKPRLPQEAVNHQETYLNQDELTSHIQAYDEQMSEYMNKRTNGKETRNWSQ
FT                   SIASYYERLYYPHIREMLEKQGFKVEK"
     atgaatgaag tgattaaatc tttaacagac caccgctcga ttcgcagcta cacagatgag        60
     cctgtagctc aggagcaatt ggaccaaatc attgaagcgg tgcaatcagc cccttcttct       120
     atcaacggac agcaagtgac tgtgatcaca gtccaggata aagagcgcaa aaagaaaatc       180
     tccgagctgg caggcggcca gccatggatc gatcaagctc ctgttttcct gctgttctgc       240
     gcagatttta accgggccaa aattgcgctt gaagatctgc atgatttcaa aatggaaatc       300
     acaaatggat tggaatctgt tcttgtcggc gcagtagacg ctggtattgc cctcggcaca       360
     gcaacagcag cggctgagtc actcggactt ggcacagttc cgatcggtgc agttcgcgga       420
     aaccctcaag agctgatcga actgcttgag cttccgaaat acgtgttccc tttatccggc       480
     cttgtcattg ggcatcctgc cgaccgttca gcgaaaaaac cgcgcttgcc gcaggaagct       540
     gtcaatcatc aggaaactta tttgaatcag gatgagctga cgtctcacat tcaggcatac       600
     gacgaacaga tgtctgaata catgaataaa cggacaaacg gaaaagaaac aagaaactgg       660
     tcacagagca tcgcttccta ctatgagcgc ctgtactatc cgcacatccg tgaaatgctt       720
     gaaaaacaag gatttaaagt tgaaaaataa                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page