(data stored in SCRATCH zone)

EMBL: AL009126.NUCA

AL009126.NUCA        Location/Qualifiers
FT   CDS_pept        complement(372154..372603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nucA"
FT                   /locus_tag="BSU_03430"
FT                   /old_locus_tag="BSU03430"
FT                   /product="endonuclease"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2841296, 7746143, 11359569,
FT                   11814663; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03430"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12137"
FT                   /db_xref="GOA:P12667"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="SubtiList:BG10838"
FT                   /db_xref="UniProtKB/Swiss-Prot:P12667"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2841296, 7746143, 11359569, 11814663"
FT                   /protein_id="CAB12137.3"
FT                   /translation="MNITTDIIKTILLVIVIIAAAAVGLIKGDFFSADQKTSQTKEYDE
FT                   TMAFPSDRYPETAKHIKDAINEGHSEVCTIDRDGAEERREQSLKDVPSKKGYDRDEWPM
FT                   AMCKEGGEGASVEYISPADNRGAGSWVGHRLTDYPDGTKVLFTIQ"
     gtgaacatca cgacggacat cataaaaacg atacttctcg tcatcgtcat catagcagct        60
     gcagctgtcg gcctgataaa aggagacttt ttctcagctg atcaaaaaac gtctcaaacg       120
     aaagaatatg atgaaacaat ggccttccca tctgaccggt atcccgaaac tgccaagcat       180
     attaaggatg cgataaatga ggggcactca gaggtgtgca ctattgacag agacggagct       240
     gaagaacgcc gcgagcaatc attaaaggac gtaccttcca aaaaggggta tgacagagat       300
     gaatggccaa tggccatgtg caaagaaggc ggtgagggag cttctgtaga atacatttct       360
     cccgctgaca accgcggagc aggctcttgg gtcgggcatc ggcttaccga ttacccagac       420
     ggcacaaagg ttttattcac aattcagtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page