(data stored in SCRATCH zone)

EMBL: AL009126.NUDT

AL009126.NUDT        Location/Qualifiers
FT   CDS_pept        488314..488763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudT"
FT                   /locus_tag="BSU_04330"
FT                   /old_locus_tag="BSU04330"
FT                   /product="putative NTP pyrophosphohydrolase"
FT                   /function="16.8: Protect"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3: Putative function from multiple
FT                   computational evidences; PubMedId: 15576788, 16513759;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04330"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12240"
FT                   /db_xref="GOA:P96590"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="SubtiList:BG11956"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96590"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12240.1"
FT                   /translation="MYTQGAFVIVLNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAA
FT                   VREILEETGYNAALSAKIGVYQRPKFQDEQHLFFGSITGGQAMADGTETAGLKWVSPGR
FT                   LPLFMVPNRKRQINDFKNGAQDVNVTVKDSGLLAAIDLLKRRLGK"
     gtgtatacac aaggtgcttt tgtgatcgta ttgaacgaaa gtcagcaaat tctgctggtg        60
     aaacgaaaag atgtccctct atgggatttg ccgggcggca gggttgatcc cggggaatcg       120
     gctgaggaag cggcagtgcg ggagatattg gaagaaacgg gatacaatgc agcgctttct       180
     gcgaaaatag gtgtttacca aaggccaaag tttcaagatg aacagcatct gtttttcgga       240
     agcattacag gcggacaagc aatggctgac ggcacagaga cagcgggatt aaagtgggtt       300
     tccccggggc gtttgccgct ttttatggtg ccgaatcgaa aaaggcagat caatgatttc       360
     aagaacggcg ctcaagatgt aaatgtcacc gtcaaggata gcgggttgct cgcggcgatc       420
     gacctgttga aaagaagact gggcaagtga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page