(data stored in ACNUC7421 zone)

EMBL: AL009126.OPUAA

AL009126.OPUAA       Location/Qualifiers
FT   CDS_pept        321013..322269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuAA"
FT                   /locus_tag="BSU_02980"
FT                   /old_locus_tag="BSU02980"
FT                   /product="L-proline betaine and betonicine ABC transporter
FT                   (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /function="16.8: Protect"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7622480, 16225868, 16645306,
FT                   25012968; Product type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02980"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12092"
FT                   /db_xref="GOA:P46920"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG11370"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46920"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7622480, 16225868, 16645306, 25012968"
FT                   /protein_id="CAB12092.2"
FT                   /translation="MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGS
FT                   TVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLNRLIEPTAGNIYIDGDMITNMSKDQ
FT                   LREVRRKKISMVFQKFALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLEGFE
FT                   HQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKT
FT                   IIFITHDLDEALRIGDRIVLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTA
FT                   GHIMKRAETVRIDKGPRVALTLMKNLGISSIYAVDKQKKLLGVIYASDAKKAAESDLSL
FT                   QDILNTEFTTVPENTYLTEIFDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEY
FT                   INAEGTNEQTQDPSAQEVK"
     atgagtgtag atgagaaacc aattaagata aaagtcgaga aagtctctaa gatttttggg        60
     aaacaaacaa agaaggcagt tcaaatgctt gccaacggaa agacaaaaaa agagatcctg       120
     aaagcaaccg gatcaaccgt tggggttaat caggcagatt ttgaagtata tgatggtgag       180
     atatttgtca tcatgggtct atcagggagc ggtaaatcaa ctttagtacg gatgttaaac       240
     cggcttattg aaccgactgc cggaaatatt tacattgatg gtgacatgat aacaaatatg       300
     tcaaaagacc agctccggga agtccgccgg aaaaaaatca gcatggtctt ccaaaagttc       360
     gctctgtttc cgcacagaac gatacttgaa aacacagaat acggactgga gcttcaaggt       420
     gtagacaaac aagagcggca gcaaaaagcg cttgagtctc ttaagctcgt tggactggaa       480
     ggatttgaac accaatatcc cgaccagctt tccggcggga tgcagcagcg tgtcggcctt       540
     gcccgcgcgt tgacgaatga cccggacatc cttctgatgg acgaagcgtt cagtgcgctc       600
     gatccactga ttcgtaaaga tatgcaggat gagcttcttg atcttcacga taatgtcgga       660
     aaaacaatta tctttattac gcatgacttg gacgaagcgt tgcggatcgg cgacagaatt       720
     gtcctaatga aggacggcaa catcgttcaa atcggcacgc ctgaagaaat cctgatgaat       780
     ccatctaacg aatatgttga gaaattcgtc gaagatgttg atttgtctaa agtcctcaca       840
     gcaggccaca ttatgaaacg cgctgaaaca gtgcggattg ataaagggcc tcgcgtagca       900
     ttgacactga tgaaaaacct tggaatttct tcaatttatg cagtggataa acaaaagaaa       960
     ttattaggtg ttatctatgc gtctgatgcg aaaaaagcgg ctgagtctga tttgtcactt      1020
     caagacatct tgaatacaga atttacgact gtaccagaga atacgtatct gactgagatt      1080
     tttgacgttg tgtccgatgc gaatattcca attgcggttg tggatgagaa gcaaagaatg      1140
     aaaggaattg tcgtaagagg cgcgctgatt ggcgcacttg ccggcaataa cgagtatatc      1200
     aatgctgaag gcactaacga acaaacacaa gatccttctg cacaggaggt gaaataa         1257
//

If you have problems or comments...

PBIL Back to PBIL home page