(data stored in ACNUC7421 zone)

EMBL: AL009126.PABA

AL009126.PABA        Location/Qualifiers
FT   CDS_pept        84290..84874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BSU_00750"
FT                   /old_locus_tag="BSU00750"
FT                   /product="4-amino-4-deoxychorismate synthase; anthranilate
FT                   synthase (subunit II)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.6.1.85"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 9098056, 16605270, 17114263,
FT                   24847778; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00750"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11851"
FT                   /db_xref="GOA:P28819"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="SubtiList:BG10138"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28819"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11851.1"
FT                   /translation="MILMIDNYDSFTYNLVQYLGELGEELVVKRNDSITIDEIEELSPD
FT                   FLMISPGPCSPDEAGISLEAIKHFAGKIPIFGVCLGHQSIAQVFGGDVVRAERLMHGKT
FT                   SDIEHDGKTIFEGLKNPLVATRYHSLIVKPETLPSCFTVTAQTKEGEIMAIRHNDLPIE
FT                   GVQFHPESIMTSFGKEMLRNFIETYRKEVIA"
     atgattttaa tgattgataa ctacgattca ttcacgtaca acttggtaca gtatttgggc        60
     gagcttgggg aagagctggt tgtgaaacgc aatgacagca tcacaatcga tgaaattgaa       120
     gaactgtctc cggactttct gatgatatct cccggaccgt gcagccctga tgaggcggga       180
     atcagcctcg aagcaattaa acatttcgca gggaaaattc ctattttcgg tgtatgtctc       240
     ggacatcagt ccatcgcaca agtgttcggt ggtgatgttg ttagggcaga acggcttatg       300
     cacgggaaaa cctcggatat cgagcatgac ggcaaaacca tttttgaagg gttgaaaaat       360
     ccccttgttg cgacgcgata ccactcgctg atcgtaaaac ctgagacgct gccaagctgt       420
     tttacagtaa cagcacaaac gaaagaagga gaaatcatgg ctattcgcca caatgacctc       480
     ccgatagagg gtgtgcaatt tcacccagag tctattatga cctcctttgg gaaagaaatg       540
     ctcagaaatt ttattgagac atatcgcaag gaagttattg cgtga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page