(data stored in SCRATCH zone)

EMBL: AL009126.PABB

AL009126.PABB        Location/Qualifiers
FT   CDS_pept        82864..84276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BSU_00740"
FT                   /old_locus_tag="BSU00740"
FT                   /product="4-amino-4-deoxychorismate synthase
FT                   (para-aminobenzoate synthase)"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.6.1.85"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 2123867, 9084182, 16605270,
FT                   17114263, 25288929; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00740"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11850"
FT                   /db_xref="GOA:P28820"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="SubtiList:BG10137"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28820"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11850.1"
FT                   /translation="MAQRRPAGKKIPFQKDSFLQQFEKLAQSRKHHVLLESARGGRYSI
FT                   AGLDPIATVKGKDGITTIKHGDEMLFKEGDPLRAFHSWFKTLETETNHEFPDFQGGAIG
FT                   FLSYDYARYIENFKMLSLDDLETPDIYFLVFDDIAVYDHQEESLWLITHVNGSDQETAD
FT                   VKLSELEQMWLTELPAVTSREMKPETAGSFAAPFTEDGFSQAVEKIKQYIASGDVFQVN
FT                   LSIRQSQSLSVHPYQIYKTLREVNPSPYMAYLETPDFQIICGSPELLVSKKGKLLETRP
FT                   IAGTRSRGKTNEEDEALANELIHNEKERAEHVMLVDLERNDLGRVSRYGSVRVNEFMAI
FT                   EKYSHVMHIVSNVQGELQDGYDAVDIIHAVFPGGTITGAPKVRTMEIIEELEPTRRGLY
FT                   TGSIGWFGYNHDLQFNIVIRTIYATGGQAFMQSGAGVVIDSVPKHEYKESFKKAFAMQR
FT                   ALELSEEETKIR"
     atggcacaac gcagaccggc aggcaaaaaa ataccttttc aaaaagactc attcttacaa        60
     caatttgaga aacttgcgca atcccggaaa catcatgtac ttctcgaaag tgcaagaggc       120
     ggcagatata gtatagccgg tcttgatcca attgcgactg tgaaaggaaa agacggaata       180
     actacaatta agcatggtga tgagatgctg tttaaagaag gtgatccatt acgggccttc       240
     cacagctggt ttaaaacact ggaaacagaa acgaatcatg agttccctga ctttcaaggc       300
     ggggcaatcg ggtttctcag ctatgattac gcacggtaca ttgaaaattt taaaatgctc       360
     tcattagatg atttagaaac accagatatt tattttcttg tttttgatga tatagcagtt       420
     tatgaccatc aagaagagtc tctatggctg attactcatg ttaatggttc tgatcaggaa       480
     acagcggatg tgaagctatc tgagttagag cagatgtggt tgactgagct tcccgctgtc       540
     acttcgcgag agatgaagcc tgaaacagct ggttctttcg cggcgccatt taccgaggat       600
     gggttctcac aagctgtaga gaaaatcaaa caatacattg ccagcggaga tgtgtttcaa       660
     gtcaatctat caataaggca gtcacagtca ctgtctgtcc acccatatca aatttacaaa       720
     accttgagag aagtaaatcc ttctccttat atggcgtatt tagaaacacc tgatttccaa       780
     atcatttgcg gatcgcctga actgcttgtc agcaaaaagg gcaagctatt agagacgaga       840
     ccgattgcgg gcacccgttc cagagggaaa acaaatgaag aagacgaggc gcttgcaaac       900
     gaattgatac acaatgaaaa agaacgcgcg gaacatgtca tgctggttga tcttgagcga       960
     aatgatctgg gaagagtatc acgttacggg tctgtgcgcg taaatgaatt catggcaatt      1020
     gaaaaatact cgcatgtgat gcacattgtg tctaatgtcc aaggtgaact gcaggatggg      1080
     tatgatgctg tagatattat tcatgctgtg tttcccggag gaaccattac tggtgcaccg      1140
     aaagtaagaa cgatggaaat tatagaagaa cttgagccga cacgccgagg gctttatact      1200
     ggatctatag gatggtttgg atataatcac gatctgcagt ttaatatcgt cattcgaacc      1260
     atttatgcaa ccggagggca ggcatttatg cagtccggtg caggagttgt gattgattct      1320
     gttccgaagc acgaatacaa ggaatcattc aaaaaagctt ttgcgatgca aagagcatta      1380
     gagctgagcg aagaagagac aaaaattaga tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page