(data stored in ACNUC7421 zone)

EMBL: AL009126.PABC

AL009126.PABC        Location/Qualifiers
FT   CDS_pept        84874..85755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BSU_00760"
FT                   /old_locus_tag="BSU00760"
FT                   /product="4-amino-4-deoxychorismate pyruvate-lyase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.1.3.38"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 10876155, 1644759, 22720735;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00760"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11852"
FT                   /db_xref="GOA:P28821"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR017824"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="SubtiList:BG10139"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28821"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11852.1"
FT                   /translation="MIYVNGRYMEEKDAVLSPFDHGFLYGIGVFETFRLYEGCPFLLDW
FT                   HIERLERALKDLQIEYTVSKHEILEMLDKLLKLNDIKDGNARVRLNISAGISDKGFVAQ
FT                   TYDKPTVLCFVNQLKPESLPLQKEGKVLSIRRNTPEGSFRLKSHHYLNNMYAKREIGND
FT                   PRVEGIFLTEDGAVAEGIISNVFWRKGRCIYTPSLDTGILDGVTRRFIIENAKDIGLEL
FT                   KTGRYELEALLTADEAWMTNSVLEIIPFTKIEEVNYGSQSGEATSALQLLYKKEIKNMI
FT                   HEKGGRAWRSTQ"
     atgatatatg tgaacggccg gtatatggag gagaaagatg cagttctttc tccttttgac        60
     catgggtttt tatatgggat cggtgttttc gaaaccttca ggctctacga aggctgcccg       120
     tttttgcttg attggcatat agagaggctt gaacgcgcgc ttaaggatct gcaaatcgaa       180
     tatactgttt caaagcatga gatccttgag atgctggaca agctgcttaa gctaaatgat       240
     atcaaggatg gcaatgcccg cgtcagactg aacatatcag cgggaatcag cgataaaggc       300
     tttgtcgccc agacgtacga taagcccacc gttttatgct ttgtgaatca gctgaaacca       360
     gaaagtcttc ctttgcaaaa agaaggaaag gttttatcga tacggagaaa cactccagag       420
     ggatcgttcc ggttaaaatc tcatcattat ctaaataata tgtatgcgaa acgggaaatt       480
     ggaaatgatc cgcgtgtcga gggaattttc ttaacggagg atggagctgt tgcagagggt       540
     atcatatcta atgtcttctg gagaaaaggt cgctgtatct atacgccatc gcttgatacc       600
     ggtattctgg acggcgtcac gagacgtttt atcatagaaa atgcaaagga tatcggcctg       660
     gagctcaaaa cgggccgata tgagctagaa gctctcttga cagctgacga agcgtggatg       720
     acgaactcgg ttcttgaaat catcccgttt actaaaatag aagaagtaaa ctatggaagc       780
     caaagcggag aagcaacctc cgctcttcaa ttgttataca aaaaagaaat aaagaacatg       840
     attcatgaaa agggaggaag agcatggcgc agcacacaat ag                          882
//

If you have problems or comments...

PBIL Back to PBIL home page