(data stored in SCRATCH zone)

EMBL: AL009126.PBTP

AL009126.PBTP        Location/Qualifiers
FT   CDS_pept        434256..435014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbtP"
FT                   /locus_tag="BSU_03820"
FT                   /old_locus_tag="BSU03820"
FT                   /product="petrobactin iron-siderophore ABC transporter
FT                   (ATP-binding protein)"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12354229, 19955416; Product
FT                   type t: transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03820"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12190"
FT                   /db_xref="GOA:P94420"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="SubtiList:BG12036"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94420"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12354229, 19955416"
FT                   /protein_id="CAB12190.1"
FT                   /translation="MVEVRNVSKQYGGKVVLEETSVTIQKGKITSFIGPNGAGKSTLLS
FT                   IMSRLIKKDSGEIYIDGQEIGACDSKELAKKMSILKQANQINIRLTIKDLVSFGRFPYS
FT                   QGRLTEEDWVHINQALSYMKLEDIQDKYLDQLSGGQCQRAFIAMVIAQDTDYIFLDEPL
FT                   NNLDMKHSVEIMKLLKRLVEELGKTIVIVIHDINFASVYSDYIVALKNGRIVKEGPPEE
FT                   MIETSVLEEIYDMTIPIQTIDNQRIGVYFS"
     atggtagagg tcagaaatgt aagcaaacaa tatggcggga aagttgttct tgaagagacg        60
     tcagtcacga ttcaaaaggg caaaatcacc tcgtttatcg gtcctaacgg cgccggcaaa       120
     agtacgctgc tgtctatcat gagccgcctg atcaaaaagg attccggcga gatttacata       180
     gacggacaag agattggagc atgtgacagc aaagagcttg ccaagaaaat gagcattttg       240
     aagcaggcga accaaatcaa tatcaggctc acgatcaaag acctcgtcag ttttggcagg       300
     tttccgtact cacagggccg gctgacagag gaagactggg ttcatatcaa ccaggcgctt       360
     agctatatga agctggaaga cattcaagac aaatacttgg atcagctgag cggcggacag       420
     tgccaaaggg catttatcgc catggtcatt gcccaggaca cagattatat ctttctggat       480
     gaaccgctga acaatctgga tatgaaacac tcagttgaaa ttatgaaact gctgaaacgg       540
     ctggtagagg agcttggaaa aacgatcgtg atcgtcattc acgatatcaa ttttgcttca       600
     gtctattctg actatatcgt cgctttgaaa aacggccgaa tcgttaaaga aggaccgcct       660
     gaagaaatga tagaaacatc agtgcttgag gaaatctacg atatgaccat cccgattcag       720
     acgattgata atcaaagaat aggtgtttat ttttcttaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page