(data stored in ACNUC7421 zone)

EMBL: AL009126.PCP

AL009126.PCP         Location/Qualifiers
FT   CDS_pept        complement(286773..287420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="BSU_02650"
FT                   /old_locus_tag="BSU02650"
FT                   /product="pyrrolidone-carboxylate (pyroglutamate)
FT                   peptidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.4.19.3"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 1362573, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02650"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12059"
FT                   /db_xref="GOA:P28618"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="SubtiList:BG10873"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28618"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:1362573, 28830929"
FT                   /protein_id="CAB12059.1"
FT                   /translation="MRKKVLITGFDPFDKETVNPSWEAAKRLNGFETEEAIITAEQIPT
FT                   VFRSALDTLRQAIQKHQPDIVICVGQAGGRMQITPERVAINLADARIPDNEGHQPIDEE
FT                   ISPDGPAAYWTRLPVKRMTAKMKEHGIPAAVSYTAGTFVCNYLFYGLMDHISRTSPHIR
FT                   GGFIHIPYIPQQTIDKTAPSLSLDTIVRALRIAAVTAAQYDEDVKSPGGTLH"
     atgagaaaaa aagtgctgat cacaggcttt gacccttttg acaaagaaac cgtcaatcca        60
     tcatgggaag cggcgaaacg gcttaatggc ttcgagacag aagaagccat tattacagcg       120
     gaacaaattc caaccgtctt tagatccgct ctggacactc tgcgccaagc cattcaaaaa       180
     catcagccag atatcgtaat ttgtgtcggc caagcaggag gacggatgca gattacaccg       240
     gaacgagtgg caatcaacct tgcagatgcg cgaatccccg ataacgaagg acatcagccg       300
     attgatgaag agatttctcc agatgggccc gccgcttact ggacaaggct tcccgtgaaa       360
     cgaatgactg ctaagatgaa ggaacacggc attccagctg cggtttccta cacagcgggg       420
     acctttgtat gcaactattt gttctacggg ttaatggatc acattagccg gacatcccca       480
     cacattcgcg gcggttttat tcatattcct tacattccgc agcaaacaat cgacaaaaca       540
     gcgccgagcc tcagcctgga cacgattgtc cgggcattga gaatcgccgc tgttacggcc       600
     gcacaatatg atgaggatgt gaagtcaccg ggtggtacgc tgcactaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page