(data stored in ACNUC7421 zone)

EMBL: AL009126.PDXS

AL009126.PDXS        Location/Qualifiers
FT   CDS_pept        19062..19946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BSU_00110"
FT                   /old_locus_tag="BSU00110"
FT                   /product="glutamine amidotransferase for pyridoxal
FT                   phosphate synthesis; pyridoxal 5'-phosphate synthase
FT                   complex, synthase subunit"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="4.-.-.-"
FT                   /EC_number="4.3.3.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14762015, 15771487, 15911615,
FT                   16157873, 17144654; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00110"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11787"
FT                   /db_xref="GOA:P37527"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="PDB:2NV1"
FT                   /db_xref="PDB:2NV2"
FT                   /db_xref="SubtiList:BG10075"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37527"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14762015, 15771487, 15911615, 16157873, 17144654"
FT                   /protein_id="CAB11787.1"
FT                   /translation="MAQTGTERVKRGMAEMQKGGVIMDVINAEQAKIAEEAGAVAVMAL
FT                   ERVPADIRAAGGVARMADPTIVEEVMNAVSIPVMAKARIGHIVEARVLEAMGVDYIDES
FT                   EVLTPADEEFHLNKNEYTVPFVCGCRDLGEATRRIAEGASMLRTKGEPGTGNIVEAVRH
FT                   MRKVNAQVRKVVAMSEDELMTEAKNLGAPYELLLQIKKDGKLPVVNFAAGGVATPADAA
FT                   LMMQLGADGVFVGSGIFKSDNPAKFAKAIVEATTHFTDYKLIAELSKELGTAMKGIEIS
FT                   NLLPEQRMQERGW"
     atggctcaaa caggtactga acgtgtaaaa cgcggaatgg cagaaatgca aaaaggcggc        60
     gtcatcatgg acgtcatcaa tgcggaacaa gcgaaaatcg ctgaagaagc tggagctgtc       120
     gctgtaatgg cgctagaacg tgtgccagca gatattcgcg cggctggagg agttgcccgt       180
     atggctgacc ctacaatcgt ggaagaagta atgaatgcag tatctatccc ggtaatggca       240
     aaagcgcgta tcggacatat tgttgaagcg cgtgtgcttg aagctatggg tgttgactat       300
     attgatgaaa gtgaagttct gacgccggct gacgaagaat ttcatttaaa taaaaatgaa       360
     tacacagttc cttttgtctg tggctgccgt gatcttggtg aagcaacacg ccgtattgcg       420
     gaaggtgctt ctatgcttcg cacaaaaggt gagcctggaa caggtaatat tgttgaggct       480
     gttcgccata tgcgtaaagt taacgctcaa gtgcgcaaag tagttgcgat gagtgaggat       540
     gagctaatga cagaagcgaa aaacctaggt gctccttacg agcttcttct tcaaattaaa       600
     aaagacggca agcttcctgt cgttaacttt gccgctggcg gcgtagcaac tccagctgat       660
     gctgctctca tgatgcagct tggtgctgac ggagtatttg ttggttctgg tatttttaaa       720
     tcagacaacc ctgctaaatt tgcgaaagca attgtggaag caacaactca ctttactgat       780
     tacaaattaa tcgctgagtt gtcaaaagag cttggtactg caatgaaagg gattgaaatc       840
     tcaaacttac ttccagaaca gcgtatgcaa gaacgcggct ggtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page