(data stored in SCRATCH zone)

EMBL: AL009126.PDXT

AL009126.PDXT        Location/Qualifiers
FT   CDS_pept        19968..20558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BSU_00120"
FT                   /old_locus_tag="BSU00120"
FT                   /product="glutamine amidotransferase for pyridoxal
FT                   phosphate synthesis; pyridoxal 5'-phosphate synthase
FT                   complex, glutamine amidotransferase subunit PdxT"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="3.5.1.2"
FT                   /EC_number="4.3.3.6"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 14585832, 14762015, 15771487,
FT                   17144654, 18271580, 26735940; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00120"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11788"
FT                   /db_xref="GOA:P37528"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:1R9G"
FT                   /db_xref="PDB:2NV0"
FT                   /db_xref="PDB:2NV2"
FT                   /db_xref="SubtiList:BG10076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37528"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:14585832, 14762015, 15771487, 17144654, 18271580,
FT                   26735940"
FT                   /protein_id="CAB11788.1"
FT                   /translation="MLTIGVLGLQGAVREHIHAIEACGAAGLVVKRPEQLNEVDGLILP
FT                   GGESTTMRRLIDTYQFMEPLREFAAQGKPMFGTCAGLIILAKEIAGSDNPHLGLLNVVV
FT                   ERNSFGRQVDSFEADLTIKGLDEPFTGVFIRAPHILEAGENVEVLSEHNGRIVAAKQGQ
FT                   FLGCSFHPELTEDHRVTQLFVEMVEEYKQKALV"
     atgttaacaa taggtgtact aggacttcaa ggagcagtta gagagcacat ccatgcgatt        60
     gaagcatgcg gcgcggctgg tcttgtcgta aaacgtccgg agcagctgaa cgaagttgac       120
     gggttgattt tgccgggcgg tgagagcacg acgatgcgcc gtttgatcga tacgtatcaa       180
     ttcatggagc cgcttcgtga attcgctgct cagggcaaac cgatgtttgg aacatgtgcc       240
     ggattaatta tattagcaaa agaaattgcc ggttcagata atcctcattt aggtcttctg       300
     aatgtggttg tagaacgtaa ttcatttggc cggcaggttg acagctttga agctgattta       360
     acaattaaag gcttggacga gccttttact ggggtattca tccgtgctcc gcatatttta       420
     gaagctggtg aaaatgttga agttctatcg gagcataatg gtcgtattgt agccgcgaaa       480
     caggggcaat tccttggctg ctcattccat ccggagctga cagaagatca ccgagtgacg       540
     cagctgtttg ttgaaatggt tgaggaatat aagcaaaagg cacttgtata a                591
//

If you have problems or comments...

PBIL Back to PBIL home page