(data stored in ACNUC7421 zone)

EMBL: AL009126.PE282

AL009126.PE282       Location/Qualifiers
FT   CDS_pept        complement(300525..300656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSU_02785"
FT                   /old_locus_tag="BSU02785"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9F5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90540.1"
FT                   /translation="MTKEGGVSRKSGENREKRTDFFGYMMLIHSKRSISQRQKTPLS"
     atgacaaagg agggcggagt ttccagaaaa tccggtgaaa accgtgagaa aagaactgat        60
     ttttttggtt atatgatgct aatccattca aaaagatcca tttctcaaag acaaaagact       120
     cccctttcct aa                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page