(data stored in SCRATCH zone)

EMBL: AL009126.PE344

AL009126.PE344       Location/Qualifiers
FT   CDS_pept        369020..369217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BSU_03385"
FT                   /old_locus_tag="BSU03385"
FT                   /product="hypothetical protein"
FT                   /note="Evidence 5: Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2K4Z9F2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SOX90541.1"
FT                   /translation="MSKDECQTYQGNACESEGCSRPVTHLCQYRKKWSRGMKPIFRINL
FT                   SLADAPKAYDIFDEKENGNI"
     ttgtccaagg atgaatgcca gacgtaccaa ggaaacgcat gtgaaagtga aggatgcagc        60
     agacccgtca ctcatctatg ccaataccgg aagaaatggt caagaggcat gaaaccgatc       120
     ttcagaataa atttaagtct tgctgatgcc cctaaggcat atgatatatt cgatgagaaa       180
     gaaaatggaa acatttaa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page