(data stored in ACNUC7421 zone)

EMBL: AL009126.PHOD

AL009126.PHOD        Location/Qualifiers
FT   CDS_pept        284011..285762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="BSU_02620"
FT                   /old_locus_tag="BSU02620"
FT                   /product="secreted phosphodiesterase (endo-hydrolysis at
FT                   non-specific sites throughout the cell wall teichoic acid
FT                   polymer)"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.4.46"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11719524, 12867413, 16698798,
FT                   19395490, 19616508, 21479178, 27780866; Product type e:
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02620"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12056"
FT                   /db_xref="GOA:P42251"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="PDB:2YEQ"
FT                   /db_xref="SubtiList:BG11174"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42251"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11719524, 12867413, 16698798, 19395490, 19616508,
FT                   21479178, 27780866"
FT                   /protein_id="CAB12056.2"
FT                   /translation="MAYDSRFDEWVQKLKEESFQNNTFDRRKFIQGAGKIAGLSLGLTI
FT                   AQSVGAFEVNAAPNFSSYPFTLGVASGDPLSDSVVLWTRLAPDPLNGGGMPKQAVPVKW
FT                   EVAKDEHFRKIVRKGTEMAKPSLAHSVHVEADGLEPNKVYYYRFKTGHELSPVGKTKTL
FT                   PAPGANVPQMTFAFASCQQYEHGYYTAYKHMAKEKLDLVFHLGDYIYEYGPNEYVSKTG
FT                   NVRTHNSAEIITLQDYRNRHAQYRSDANLKAAHAAFPWVVTWDDHEVENNYANKIPEKG
FT                   QSVEAFVLRRAAAYQAYYEHMPLRISSLPNGPDMQLYRHFTYGNLASFNVLDTRQYRDD
FT                   QANNDGNKPPSDESRNPNRTLLGKEQEQWLFNNLGSSTAHWNVLAQQIFFAKWNFGTSA
FT                   SPIYSMDSWDGYPAQRERVINFIKSKNLNNVVVLTGDVHASWASNLHVDFEKTSSKIFG
FT                   AEFVGTSITSGGNGADKRADTDQILKENPHIQFFNDYRGYVRCTVTPHQWKADYRVMPF
FT                   VTEPGAAISTRASFVYQKDQTGLRKVSSTTIQGGVKQSDEVEEDRFFSHNKAHEKQMIK
FT                   KRAKITN"
     atggcatacg acagtcgttt tgatgaatgg gtacagaaac tgaaagagga aagctttcaa        60
     aacaatacgt ttgaccgccg caaatttatt caaggagcgg ggaagattgc aggactttct       120
     cttggattaa cgattgccca gtcggttggg gcctttgaag taaatgctgc gcctaacttc       180
     tcaagctatc cgtttacatt aggggtagcg tcaggtgatc cgctttctga cagtgtcgtg       240
     ctttggacac gtctggcacc agatccgctg aatggcgggg gaatgccgaa gcaagcagtg       300
     cctgtcaaat gggaggtcgc aaaggatgag catttccgca aaatcgtaag aaaaggcact       360
     gaaatggcta aaccaagtct tgcccattcc gttcatgtgg aagcggacgg gcttgagcca       420
     aacaaagtgt actattaccg tttcaaaacc ggccatgaac taagccctgt cggaaaaaca       480
     aaaacactgc ctgcccctgg cgccaatgtg ccgcaaatga cctttgcatt tgcttcctgc       540
     cagcaatatg agcacggata ttatacggcc tacaagcata tggcaaagga aaagcttgat       600
     cttgtcttcc atctcggtga ttacatatat gaatacggcc caaatgaata tgtatcaaaa       660
     acaggcaatg tccgcacgca caacagcgcg gaaatcatta cgctgcaaga ctatcggaac       720
     cgtcacgctc aataccgttc tgacgccaat cttaaagctg cacatgcggc attcccttgg       780
     gttgtaactt gggatgacca tgaagttgaa aacaactatg ccaataaaat acctgaaaaa       840
     ggacagtcgg ttgaagcatt cgtgctccgc cgcgcggcag cataccaggc atactatgaa       900
     catatgccgc tccgcatttc ctctttgccg aatggcccag atatgcagct gtaccggcac       960
     tttacgtacg gaaacctggc gtccttcaat gtgcttgata cccgccagta cagggacgac      1020
     caagccaata acgacggcaa taagccgcct tctgatgaat cgcgcaatcc gaatcggact      1080
     ctgcttggaa aagaacagga gcagtggctc ttcaacaatt tgggcagctc gacagcccac      1140
     tggaatgtgc tggcgcagca gattttcttt gccaagtgga atttcgggac aagcgcaagc      1200
     ccgatctaca gcatggattc gtgggacggc tacccggctc agcgcgaacg ggttatcaat      1260
     ttcattaaaa gcaaaaatct gaataatgtt gtcgtactga caggtgatgt acacgcaagc      1320
     tgggcatcga atttgcatgt cgatttcgag aagacaagtt caaaaatatt cggagccgaa      1380
     tttgttggaa cctcgatcac ttccggaggg aacggagcgg ataagcgagc ggatacggac      1440
     caaattttaa aagaaaatcc gcacatccag ttctttaacg actatcgcgg atatgtccgc      1500
     tgtacagtga cgcctcacca gtggaaagcc gattatcggg tgatgccatt tgtgaccgag      1560
     ccgggcgcag ccatttccac gcgggcttca ttcgtttacc agaaagacca aaccgggttg      1620
     agaaaggtat catccacaac aatccaaggc ggggtgaagc aatccgatga ggtcgaagag      1680
     gatcgtttct tttcgcacaa caaagcccac gaaaaacaaa tgattaagaa gcgtgcaaaa      1740
     atcacgaatt aa                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page