(data stored in SCRATCH zone)

EMBL: AL009126.POXB

AL009126.POXB        Location/Qualifiers
FT   CDS_pept        488830..490554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="poxB"
FT                   /locus_tag="BSU_04340"
FT                   /old_locus_tag="BSU04340"
FT                   /product="acetyl-phosphate generating pyruvate oxidase"
FT                   /function="16.6: Maintain"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.3.3"
FT                   /note="Evidence 2a: Function from experimental evidences in
FT                   other organisms; PubMedId: 16291680, 16513748, 10220166,
FT                   23611909; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04340"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12241"
FT                   /db_xref="GOA:P96591"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="SubtiList:BG12063"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96591"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12241.1"
FT                   /translation="MAHKTAGQAMTELLEQWGVDHVYGIPGDSINEFIEELRHERNQLK
FT                   FIQTRHEEVAALAAAAEAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQV
FT                   SSGEVGRDYFQEIKLEQMFEDVAVFNREVHSAESLPDLLNQAIRTAYSKKGVAVLSVSD
FT                   DLFAEKIKREPVYTSPVYIEGNLEPKKEQLVTCAQYINNAKKPIILAGQGMKKAKRELL
FT                   EFADKAAAPIVVTLPAKGVVPDKHPHFLGNLGQIGTKPAYEAMEECDLLIMLGTSFPYR
FT                   DYLPDDTPAIQLDSDPAKIGKRYPVTAGLVCDSALGLRELTEYIERKEDRRFLNACTEH
FT                   MQHWWNEIEKDETEATTPLKPQQVVARLQEAAADDAVLSVDVGTVTVWMARHFKMNANQ
FT                   DFIVSSWLATMGCGLPGAIAASLSEPERQAIAVCGDGGFSMVMQDLPTAVKYKLPITVV
FT                   ILNNENLGMIEYEQQVKGNIDYVTKLQNVDYAAFAESCGAKGIKVTKAEELAPAFHEAL
FT                   HSDQPVVVDVMIGNEPPLPGKITYGQAKGFSKYMLKNFFENQKFEMPSLKKSLKRLF"
     atggcacaca aaactgcagg acaagcaatg acagagctgc ttgagcaatg gggagttgat        60
     catgtatacg gcatccccgg agacagtata aatgagttta tcgaagaatt aagacacgaa       120
     agaaatcaac tgaagttcat tcaaacccgc cacgaagagg tagcggcact ggcagccgcg       180
     gctgaagcaa aactcaccgg caagatcgga gtctgtctgt caatcgcagg gccgggagcg       240
     gtgcacttat taaatggttt atatgatgct aaagccgacg gcgcccctgt gctggcgatt       300
     gcaggacagg tttcttctgg cgaagtcgga cgggactatt tccaggagat taagctggag       360
     caaatgtttg aggacgtggc cgtgttcaac agagaggtac atagcgcgga atcacttccg       420
     gatctcttaa atcaggcgat caggaccgcc tacagcaaaa aaggcgttgc ggtattgagc       480
     gtgtcagatg atttgtttgc ggagaaaatc aaacgggagc ccgtgtatac ttcaccggtg       540
     tatattgaag ggaacctaga accgaaaaaa gaacagctcg tcacctgcgc ccaatatatt       600
     aataacgcta agaaaccgat tatcctggca gggcagggaa tgaaaaaggc gaaacgggag       660
     ctcttagaat ttgcggacaa agccgccgct ccgatcgttg ttacactccc ggcaaagggt       720
     gttgttcccg ataagcaccc acattttctc ggcaacctcg gtcagatcgg aacaaagccg       780
     gcttacgagg caatggagga atgtgattta ttaatcatgc tcggaacgtc attcccgtac       840
     cgtgattatt tgcctgatga cacgccggcg atacagctcg attcagaccc ggcaaaaatc       900
     ggaaaacggt atccggtgac agcgggcctt gtctgtgatt cggctctcgg tttgcgcgaa       960
     ttgacagagt atattgaacg caaggaagac agaagattcc tgaatgcctg cacagaacat      1020
     atgcagcatt ggtggaacga aattgaaaaa gatgagacag aggcaacaac accgcttaaa      1080
     cctcagcagg tcgtggcccg tcttcaggaa gcggcagccg atgatgcggt gctctctgta      1140
     gatgtcggca ctgtgacagt ctggatggcg cgtcatttca aaatgaacgc gaatcaggat      1200
     ttcatcgttt ccagctggct tgcgacaatg ggctgcggcc tgccgggagc gattgcagcg      1260
     agcttgtccg aaccggaacg ccaggcgatc gccgtctgcg gtgacggggg attttccatg      1320
     gtcatgcagg accttccgac cgccgttaaa tataagctcc cgatcacagt cgttatttta      1380
     aacaacgaaa atctcggcat gattgagtac gagcagcagg tcaaaggcaa tatcgactat      1440
     gtcacaaaac ttcaaaatgt cgactatgcc gcatttgcag aaagctgcgg agcaaagggc      1500
     atcaaagtga ccaaagcgga agagcttgcg ccggcttttc atgaggcgct gcactctgac      1560
     caaccggtcg tagtggatgt catgattgga aacgaaccgc cgcttcctgg caaaatcacc      1620
     tacgggcagg cgaaaggctt tagcaagtac atgctgaaaa acttcttcga aaaccaaaaa      1680
     tttgaaatgc cgtcactgaa gaaaagtttg aaacggttat tttaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page