(data stored in ACNUC7421 zone)

EMBL: AL009126.PRKT

AL009126.PRKT        Location/Qualifiers
FT   CDS_pept        73809..74825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkT"
FT                   /locus_tag="BSU_00660"
FT                   /old_locus_tag="BSU00660"
FT                   /product="serine/threonine-protein kinase"
FT                   /function="16.3: Control"
FT                   /EC_number="2.7.11.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 23634894, 24731262, 25278935;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00660"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11842"
FT                   /db_xref="GOA:P37562"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="PDB:6G4J"
FT                   /db_xref="SubtiList:BG10129"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37562"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:23634894, 24731262, 25278935"
FT                   /protein_id="CAB11842.2"
FT                   /translation="MMNDALTSLACSLKPGTTIKGKWNGNTYTLRKQLGKGANGIVYLA
FT                   ETSDGHVALKVSDDSLSITSEVNVLKSFSKAQSVTMGPSFFDTDDAYIPSANTKVSFYA
FT                   MEYIKGPLLLKYVSDKGAEWIPVLMIQLLSSLSVLHQQGWIFGDLKPDNLIVTGPPARI
FT                   RCIDVGGTTKEGRAIKEYTEFYDRGYWGYGTRKAEPSYDLFAVAMIMINSVHKKEFKKT
FT                   NQPKEQLRSLIEGNPLLQKYKKALFSALNGDYQSADEMKKDMLDAGQKAAQRKQPIKAS
FT                   PQPATRQRQQKPRQGKITKTRYTPKQKPAKSGGLFETTLIVISVLALYFAYIIFFLI"
     atgatgaacg acgctttgac gagtttggca tgtagcctca agccgggtac gacaatcaaa        60
     ggcaagtgga atggaaacac ttatacattg cgtaaacagc ttggtaaagg ggccaatgga       120
     attgtgtatt tggcagaaac atcagatgga catgttgcct taaaggtgag tgatgacagc       180
     ctgtctatta cttctgaagt gaatgtcttg aaatctttct caaaggccca gtccgttacg       240
     atggggcctt ctttttttga tacggatgat gcctatattc ccagtgccaa tacgaaagtt       300
     tcattttatg caatggaata cataaaaggg ccgctgcttt tgaagtatgt cagtgataaa       360
     ggagcagagt ggataccggt attaatgatt cagctgttat ccagcttatc ggtgcttcac       420
     cagcaaggat ggatattcgg cgatcttaaa cctgataatc tgatcgtaac tggtccgccc       480
     gcaaggatcc gctgcattga tgtgggcggc acgacaaagg aaggccgggc gataaaagag       540
     tatacggagt tttatgacag aggctattgg gggtatggaa caagaaaggc agagccatcc       600
     tatgatctgt tcgcagttgc catgattatg atcaacagtg tgcataaaaa agaatttaag       660
     aaaacgaacc agcccaaaga acagcttagg tctctcatcg aaggaaaccc gctgcttcaa       720
     aagtataaaa aagcgctttt ttcagccttg aacggagatt atcaatccgc agatgaaatg       780
     aaaaaggata tgctagacgc ggggcaaaaa gcagcacaaa gaaaacagcc tataaaagca       840
     tcaccgcagc ctgccacacg acaaagacag caaaaaccgc gccaaggaaa aataacgaag       900
     acgcgatata ccccaaaaca gaaaccggct aagtcggggg ggttatttga aacaacgctt       960
     atcgtgatca gtgttttagc gctttatttc gcctatatta tctttttctt aatctga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page