(data stored in ACNUC7421 zone)

EMBL: AL009126.PRS

AL009126.PRS         Location/Qualifiers
FT   CDS_pept        57745..58698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BSU_00510"
FT                   /old_locus_tag="BSU00510"
FT                   /product="phosphoribosylpyrophosphate synthetase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.7.6.1"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 2169413, 3038693, 8522540,
FT                   22083279, 25890046; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00510"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11827"
FT                   /db_xref="GOA:P14193"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="PDB:1DKR"
FT                   /db_xref="PDB:1DKU"
FT                   /db_xref="PDB:1IBS"
FT                   /db_xref="SubtiList:BG10114"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14193"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:2169413, 3038693, 8522540, 22083279, 25890046"
FT                   /protein_id="CAB11827.1"
FT                   /translation="MSNQYGDKNLKIFSLNSNPELAKEIADIVGVQLGKCSVTRFSDGE
FT                   VQINIEESIRGCDCYIIQSTSDPVNEHIMELLIMVDALKRASAKTINIVIPYYGYARQD
FT                   RKARSREPITAKLFANLLETAGATRVIALDLHAPQIQGFFDIPIDHLMGVPILGEYFEG
FT                   KNLEDIVIVSPDHGGVTRARKLADRLKAPIAIIDKRRPRPNVAEVMNIVGNIEGKTAIL
FT                   IDDIIDTAGTITLAANALVENGAKEVYACCTHPVLSGPAVERINNSTIKELVVTNSIKL
FT                   PEEKKIERFKQLSVGPLLAEAIIRVHEQQSVSYLFS"
     atgtctaatc aatacggaga taagaattta aagatttttt ctttgaattc gaatccagag        60
     cttgcaaaag aaatcgcaga tatagttgga gttcaattag ggaaatgttc tgtcacaaga       120
     tttagtgacg gggaagtcca aattaatatc gaagaaagta ttcgcggatg tgattgttac       180
     atcatccagt ctacaagtga ccccgttaac gagcatatta tggaactgct gattatggta       240
     gatgcgttaa aacgcgcttc tgcaaaaacg attaacattg ttattcctta ttacggttat       300
     gcgcgtcaag acagaaaagc aagatcccgt gagccaatca cagctaaact tttcgctaac       360
     ctgcttgaaa cagccggtgc gactcgtgtg attgcacttg acctgcatgc gccgcaaatt       420
     caaggattct ttgatatacc gattgaccac ttaatgggtg ttccgatttt aggagaatat       480
     tttgaaggca aaaatcttga agatatcgtc attgtttcac cagaccatgg cggtgtgaca       540
     cgtgcccgca aactggctga ccgactaaaa gcgccaattg cgattatcga taaacgccgt       600
     ccgcgtccaa acgtggcgga agtcatgaat attgtaggta acatcgaagg gaagactgct       660
     atcctcatcg atgacattat tgatactgca ggtacgatta cacttgctgc taatgcgctc       720
     gttgaaaacg gagcgaaaga agtatatgca tgctgtacac accctgtact atcaggccct       780
     gcggttgaac ggattaataa ttcaacaatt aaagagcttg ttgtgacaaa cagcatcaag       840
     cttcctgaag aaaagaaaat tgaacgcttt aagcagcttt cagtcggacc gcttctggcc       900
     gaagcgatta ttcgcgttca tgagcagcaa tcagtcagct atctgttcag ctaa             954
//

If you have problems or comments...

PBIL Back to PBIL home page