(data stored in ACNUC7421 zone)

EMBL: AL009126.PSD

AL009126.PSD         Location/Qualifiers
FT   CDS_pept        248749..249540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BSU_02290"
FT                   /old_locus_tag="BSU02290"
FT                   /product="phosphatidylserine decarboxylase; 32 kDa
FT                   precursor processed into a 29 kDa protein"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="4.1.1.65"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14762009, 9422599;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02290"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12023"
FT                   /db_xref="GOA:P39822"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="SubtiList:BG11013"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39822"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14762009, 9422599"
FT                   /protein_id="CAB12023.1"
FT                   /translation="MFNTAVKILYRSLIELTNHRLSSYLIKGFCESKISKPVIPLFSKH
FT                   FRLNWDDVDGTAADYGSLSELFIRQINLERRPVSKEAHAVVSPVDGVVQTVGIINPNQT
FT                   FTVKGKDYSFAELTGCKSADHQYNGGYFVVLYLSPRHYHRFHSPISCRYQKLAELGNRS
FT                   YPVNQLGLKYGKDVLSKNYRFVYELNSGSRNVLMIPVGAMNINSIVQTNTRTELEIGEE
FT                   LGYFSFGSTVILVFEKDAFQPSAHLAEGQEVQVGELIGYEE"
     atgtttaata cggctgtaaa gattctgtat cgatcattga tagagctgac gaatcatcgt        60
     ctgtcatcct atctgattaa aggattttgc gagtcgaaaa tcagcaaacc ggtcattccg       120
     cttttctcaa aacattttcg gctgaattgg gatgatgtgg acggtacggc tgctgattac       180
     ggatcgctgt ccgaattgtt cattcgacaa ataaatctgg agcggcgccc tgtgtcaaaa       240
     gaggcgcatg cggtggtcag ccctgttgac ggtgtggttc agacggtagg aatcatcaac       300
     ccgaatcaaa cctttacggt gaagggaaaa gattactcat tcgctgagct gaccggctgt       360
     aaaagcgcag accatcaata caacggcgga tatttcgtcg tgctgtattt aagcccgagg       420
     cattatcacc gtttccattc tccgatcagc tgcaggtatc aaaagctggc cgagctcgga       480
     aatcgctcat acccggtaaa tcaactaggc ttaaaatacg ggaaagatgt gctgtcgaaa       540
     aattatcggt ttgtgtacga gctgaatagc ggcagccgaa atgtcctgat gattcctgtc       600
     ggcgcgatga atattaattc tatcgtgcag acgaataccc gtactgaatt ggagatcggc       660
     gaggagctgg gatacttttc atttggctca accgtcattt tggtttttga aaaagacgcg       720
     ttccagccgt ccgcccattt agcagaaggc caagaagtcc aagtcggaga actgataggt       780
     tacgaagaat aa                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page