(data stored in ACNUC7421 zone)

EMBL: AL009126.PSSA

AL009126.PSSA        Location/Qualifiers
FT   CDS_pept        247744..248277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BSU_02270"
FT                   /old_locus_tag="BSU02270"
FT                   /product="phosphatidylserine synthase"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /function="16.13: Shape"
FT                   /EC_number="2.7.8.8"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 12682299, 14762009, 15743965,
FT                   15849754, 16850406; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02270"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12021"
FT                   /db_xref="GOA:P39823"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="SubtiList:BG11012"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39823"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:12682299, 14762009, 15743965, 15849754, 16850406"
FT                   /protein_id="CAB12021.1"
FT                   /translation="MNYIPCMITIGNFICGLLAIHSLLYHNIHSAVLFIFTGMFLDFFD
FT                   GMAARKLNAVSDMGRELDSFADLVTFGVAPSMLAYSVALYTLPFIGILCALTYSICGML
FT                   RLSKFNIEQSKLPTFIGMPIPFAGMCLVILSFTYNPILLAIGTCGLSYLMVSKIKFPHF
FT                   KKHAAENLESGRWN"
     gtgaattaca tcccctgtat gattacgata ggaaacttca tttgcggatt gctggcgatt        60
     cattccttgc tatatcacaa cattcattca gcagtgcttt ttatttttac aggcatgttc       120
     cttgatttct ttgacgggat ggctgctcgt aagctgaatg ccgtttctga tatggggaga       180
     gaactggatt cgtttgccga tctggttacg tttggggtgg ctccttctat gcttgcttac       240
     agtgtcgcgt tgtataccct gccatttatc gggatcttat gcgcattgac gtacagcatt       300
     tgcggaatgc ttcgcctctc taaatttaac attgaacaaa gcaagctccc gacgtttatc       360
     ggtatgccga ttccgtttgc gggcatgtgt ctcgttattc taagcttcac ctataacccg       420
     atccttctgg caatcggcac ttgcggactc tcatatttga tggtgagtaa aataaaattc       480
     cctcatttta aaaaacatgc ggcagaaaac ctggagtctg ggagatggaa ttag             534
//

If you have problems or comments...

PBIL Back to PBIL home page