(data stored in SCRATCH zone)

EMBL: AL009126.PTH

AL009126.PTH         Location/Qualifiers
FT   CDS_pept        59504..60070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="BSU_00530"
FT                   /old_locus_tag="BSU00530"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.1.1.29"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 8635758, 12100553, 12682299;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00530"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11829"
FT                   /db_xref="GOA:P37470"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="SubtiList:BG10116"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37470"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:8635758, 12100553, 12682299"
FT                   /protein_id="CAB11829.1"
FT                   /translation="MLVIAGLGNPGKNYENTRHNVGFMVIDQLAKEWNIELNQNKFNGL
FT                   YGTGFVSGKKVLLVKPLTYMNLSGECLRPLMDYYDVDNEDLTVIYDDLDLPTGKIRLRT
FT                   KGSAGGHNGIKSLIQHLGTSEFDRIRIGIGRPVNGMKVVDYVLGSFTKEEAPEIEEAVD
FT                   KSVKACEASLSKPFLEVMNEFNAKV"
     atgcttgtga ttgccggtct cggaaacccg gggaagaact atgaaaatac acggcataat        60
     gtcggattta tggtgataga tcagcttgca aaggaatgga atatagagct gaatcaaaat       120
     aaatttaacg gattatacgg aaccggattt gtttccggca aaaaggttct acttgttaaa       180
     ccgcttacat atatgaattt atcaggagaa tgtttgcggc ctttaatgga ctactatgat       240
     gtcgataacg aagatttgac agtcatttac gacgaccttg accttccgac tggcaagatc       300
     cgtttaagaa cgaaaggaag cgccggaggg cacaatggca tcaaatcact gatccagcat       360
     cttggaacgt ccgagtttga ccgtatccgc atcggaatcg gccggcctgt aaacggcatg       420
     aaggtcgttg attatgtgtt aggctccttt accaaggagg aggcacctga gatcgaagaa       480
     gcggttgata aatctgtgaa ggcttgtgag gcttctttga gtaaaccgtt tttagaagtc       540
     atgaacgaat ttaacgcaaa ggtataa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page