(data stored in ACNUC7421 zone)

EMBL: AL009126.PURT

AL009126.PURT        Location/Qualifiers
FT   CDS_pept        243892..245046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /locus_tag="BSU_02230"
FT                   /old_locus_tag="BSU02230"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /function="16.2: Construct biomass (Anabolism)"
FT                   /EC_number="2.1.2.-"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 7496533; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU02230"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12017"
FT                   /db_xref="GOA:P39771"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="SubtiList:BG10924"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39771"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:7496533"
FT                   /protein_id="CAB12017.1"
FT                   /translation="MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVA
FT                   HNSYVVDMLDPEQIRTIIEKENPDLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTM
FT                   DREGIRRLAAETLGLATAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRSE
FT                   ADLESCWETAMEGGRVKNGRVIVEEFIPFESEITLLTVRAVNGTAFCEPIGHVQKDGDY
FT                   IESWQPHDMTEQQIEEAKHIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGL
FT                   VTLVTQNLSEFALHVRAILGFPITEITQLSPGASRPLKAPEELADYTVEGLENALAVPK
FT                   TQVRVFGKPITKAGRRMAVALSAADSVETARENAKKALDQLILK"
     atgtatcaat caaagaaggt tttattgtta ggttcaggtg aattaggtaa agaggtagtg        60
     attgaagccc agcgtcttgg ggtacagacg gtggcagttg acagttacga gcatgctccg       120
     gcgatgcagg tcgcgcataa cagttatgtc gttgatatgc tggacccaga gcagatcaga       180
     accatcattg agaaagaaaa tccggatttg attgtgcctg aggttgaggc gattgcgacg       240
     gatgaattgc tgaagcttga agaggaagga tttcacgtta tcccgaatgc ccgtgcggcc       300
     aagctgacga tggatcggga aggcatcaga cgacttgcgg cggaaacgct tggacttgcg       360
     acagctggct atgaatttgc gaatacatat gatgaattta tacaagcggc agctcagatc       420
     ggttttcctt gtgtcgttaa accattgatg agttcttctg gaaaaggcca aagtgtgtgc       480
     cgctctgaag cggatttaga gagctgctgg gagacggcga tggaaggcgg acgggtgaaa       540
     aacggccgcg tgatcgttga ggagtttatc cctttcgaat cagaaatcac actcttaacc       600
     gtacgtgcgg ttaacggtac ggcattttgt gagccgatcg gtcatgtgca aaaggacggg       660
     gattatatcg aatcgtggca gccgcatgat atgacagagc agcaaataga agaagcgaag       720
     catattgcga aaacgatcac ggatgagctt ggcggatacg gcctgtttgg tgttgagctg       780
     ttccttgcga aagatagggt atatttcagt gaggtatctc ctcgtccgca tgatacgggt       840
     cttgtcacgc tggtgacgca aaatttgtca gaatttgcgc tgcatgtccg ggcgattctc       900
     ggctttccga ttacagaaat cacacagctt tctcctggcg ccagcaggcc cctcaaagcg       960
     ccggaagaat tagcggatta cactgttgaa ggattggaaa acgcactggc agtcccaaag      1020
     actcaagtgc gcgtctttgg aaagccgata acaaaagccg gacgtcgtat ggcagttgcg      1080
     ctttctgctg ctgattcagt tgaaacggca agagagaatg caaagaaagc gttggaccag      1140
     ctaattttaa aatag                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page