(data stored in ACNUC7421 zone)

EMBL: AL009126.PUTB

AL009126.PUTB        Location/Qualifiers
FT   CDS_pept        344551..345462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putB"
FT                   /locus_tag="BSU_03200"
FT                   /old_locus_tag="BSU03200"
FT                   /product="proline oxidase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.5.5.2"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17536821, 2118500, 21840319,
FT                   22139509, 26735940; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03200"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12114"
FT                   /db_xref="GOA:P94390"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="SubtiList:BG12011"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94390"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17536821, 2118500, 21840319, 22139509, 26735940"
FT                   /protein_id="CAB12114.1"
FT                   /translation="MITRDFFLFLSKSGFLNKMARNWGSRVAAGKIIGGNDFNSSIPTI
FT                   RQLNSQGLSVTVDHLGEFVNSAEVARERTEECIQTIATIADQELNSHVSLKMTSLGLDI
FT                   DMDLVYENMTKILQTAEKHKIMVTIDMEDEVRCQKTLDIFKDFRKKYEHVSTVLQAYLY
FT                   RTEKDIDDLDSLNPFLRLVKGAYKESEKVAFPEKSDVDENYKKIIRKQLLNGHYTAIAT
FT                   HDDKMIDFTKQLAKEHGIANDKFEFQMLYGMRSQTQLSLVKEGYNMRVYLPYGEDWYGY
FT                   FMRRLAERPSNIAFAFKGMTKK"
     gtgatcacaa gagatttttt cttattttta tccaaaagcg gctttctcaa taaaatggcg        60
     aggaactggg gaagtcgggt agcagcgggt aaaattatcg gcgggaatga ctttaacagt       120
     tcaatcccga ccattcgaca gcttaacagc caaggcttgt cagttactgt cgatcattta       180
     ggcgagtttg tgaacagcgc cgaggtcgca cgggagcgta cggaagagtg cattcaaacc       240
     attgcgacca tcgcggatca ggagctgaac tcacacgttt ctttaaaaat gacgtcttta       300
     ggtttggata tagatatgga tttggtgtat gaaaatatga caaaaatcct tcagacggcc       360
     gagaaacata aaatcatggt caccattgac atggaggacg aagtcagatg ccagaaaacg       420
     cttgatattt tcaaagattt cagaaagaaa tacgagcatg tgagcacagt gctgcaagcc       480
     tatctgtacc ggacggaaaa agacattgac gatttggatt ctttaaaccc gttccttcgc       540
     cttgtaaaag gagcttataa agaatcagaa aaagtagctt tcccggagaa aagcgatgtc       600
     gatgaaaatt acaaaaaaat catccgaaag cagctcttaa acggtcacta tacagcgatt       660
     gccacacatg acgacaaaat gatcgacttt acaaagcagc ttgccaagga acatggcatt       720
     gccaatgaca agtttgaatt tcagatgctg tacggcatgc ggtcgcaaac ccagctcagc       780
     ctcgtaaaag aaggttataa catgagagtc tacctgccat acggcgagga ttggtacggc       840
     tactttatga gacgccttgc agaacgtccg tcaaacattg catttgcttt caaaggaatg       900
     acaaagaagt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page