(data stored in ACNUC7421 zone)

EMBL: AL009126.PUTC

AL009126.PUTC        Location/Qualifiers
FT   CDS_pept        345479..347026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putC"
FT                   /locus_tag="BSU_03210"
FT                   /old_locus_tag="BSU03210"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.88"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 11418582, 17183215, 21840319,
FT                   22139509, 25355936; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03210"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12115"
FT                   /db_xref="GOA:P94391"
FT                   /db_xref="InterPro:IPR005932"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="SubtiList:BG12012"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94391"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:11418582, 17183215, 21840319, 22139509, 25355936"
FT                   /protein_id="CAB12115.2"
FT                   /translation="MTTPYKHEPFTNFQDQNNVEAFKKALATVSEYLGKDYPLVINGER
FT                   VETEAKIVSINPADKEEVVGRVSKASQEHAEQAIQAAAKAFEEWRYTSPEERAAVLFRA
FT                   AAKVRRRKHEFSALLVKEAGKPWNEADADTAEAIDFMEYYARQMIELAKGKPVNSREGE
FT                   KNQYVYTPTGVTVVIPPWNFLFAIMAGTTVAPIVTGNTVVLKPASATPVIAAKFVEVLE
FT                   ESGLPKGVVNFVPGSGAEVGDYLVDHPKTSLITFTGSREVGTRIFERAAKVQPGQQHLK
FT                   RVIAEMGGKDTVVVDEDADIELAAQSIFTSAFGFAGQKCSAGSRAVVHEKVYDQVLERV
FT                   IEITESKVTAKPDSADVYMGPVIDQGSYDKIMSYIEIGKQEGRLVSGGTGDDSKGYFIK
FT                   PTIFADLDPKARLMQEEIFGPVVAFCKVSDFDEALEVANNTEYGLTGAVITNNRKHIER
FT                   AKQEFHVGNLYFNRNCTGAIVGYHPFGGFKMSGTDSKAGGPDYLALHMQAKTISEMF"
     atgacaacac cttacaaaca cgagccattc acaaatttcc aagatcaaaa caacgtggaa        60
     gcgtttaaaa aagcgcttgc gacagtaagc gaatatttag gaaaagacta tccgcttgtc       120
     attaacggcg agagagtgga aacggaagcg aaaatcgttt caatcaaccc agctgataaa       180
     gaagaagtcg tcggccgagt gtcaaaagcg tctcaagagc acgctgagca agcgattcaa       240
     gcggctgcaa aagcatttga agagtggaga tacacgtctc ctgaagagag agcggctgtc       300
     ctgttccgcg ctgctgccaa agtccgcaga agaaaacatg aattctcagc tttgcttgtg       360
     aaagaagcag gaaagccttg gaacgaggcg gatgccgata cggctgaagc gattgacttc       420
     atggagtatt atgcacgcca aatgatcgaa ctggcaaaag gcaaaccggt caacagccgt       480
     gaaggcgaga aaaaccaata tgtatacacg ccgactggag tgacagtcgt tatcccgcct       540
     tggaacttct tgtttgcgat catggcaggc acaacagtgg cgccgatcgt tactggaaac       600
     acagtggttc tgaaacctgc gagtgctaca cctgttattg cagcaaaatt tgttgaggtg       660
     cttgaagagt ccggattgcc aaaaggcgta gtcaactttg ttccgggaag cggagcggaa       720
     gtaggcgact atcttgttga ccatccgaaa acaagcctta tcacatttac gggatcaaga       780
     gaagttggta cgagaatttt cgaacgcgcg gcgaaggttc agccgggcca gcagcattta       840
     aagcgtgtca tcgctgaaat gggcggtaaa gatacggttg ttgttgatga ggatgcggac       900
     attgaattag cggctcaatc gatctttact tcagcattcg gctttgcggg acaaaaatgc       960
     tctgcaggtt cacgtgcagt agttcatgaa aaagtgtatg atcaagtatt agagcgtgtc      1020
     attgaaatta cggaatcaaa agtaacagct aaacctgaca gtgcagatgt ttatatggga      1080
     cctgtcattg accaaggttc ttatgataaa attatgagct atattgagat cggaaaacag      1140
     gaagggcgtt tagtaagcgg cggtactggt gatgattcga aaggatactt catcaaaccg      1200
     acgatcttcg ctgaccttga tccgaaagca agactcatgc aggaagaaat tttcggacct      1260
     gtcgttgcat tttgtaaagt gtcagacttt gatgaagctt tagaagtggc aaacaatact      1320
     gaatatggtt tgacaggcgc ggttatcaca aacaaccgca agcacatcga gcgtgcgaaa      1380
     caggaattcc atgtcggaaa cctatacttc aaccgcaact gtacaggtgc tatcgtcggc      1440
     taccatccgt ttggcggctt caaaatgtcg ggaacggatt caaaagcagg cgggccggat      1500
     tacttggctc tgcatatgca agcaaaaaca atcagtgaaa tgttctaa                   1548
//

If you have problems or comments...

PBIL Back to PBIL home page