(data stored in ACNUC7421 zone)

EMBL: AL009126.PXPA

AL009126.PXPA        Location/Qualifiers
FT   CDS_pept        457023..457796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpA"
FT                   /locus_tag="BSU_04050"
FT                   /old_locus_tag="BSU04050"
FT                   /product="oxoprolinase subunit A"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04050"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12213"
FT                   /db_xref="GOA:P42963"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="SubtiList:BG11227"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42963"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 28830929"
FT                   /protein_id="CAB12213.3"
FT                   /translation="MFQIDLNCDLGESFGAYKIGLDQDILEYVTSANIACGFHAGDPSV
FT                   MRKTVALAAERGVKMGAHPGLPDLLGFGRRNMAISPEEAYDLVVYQIGALSGFLKAEGL
FT                   HMQHVKPHGALYNMAAVDQKLSDAIAKAVYKVDPGLILFGLAESELVKAGERIGLQTAN
FT                   EVFADRTYQSDGTLTPRSQPDALIESDDAAVTQVIKMVKEGAVKSQQGHDVSLKADTVC
FT                   IHGDGAHALTFAQKIRKQLKAAGIEVTAISEQRST"
     gtgtttcaga ttgatttaaa ctgtgattta ggagaaagct tcggagccta caagataggc        60
     cttgaccaag atattttaga gtatgtgaca tcagcgaata tcgcatgcgg atttcatgca       120
     ggagatccta gtgttatgcg aaaaaccgtc gcgcttgcag cagaaagagg cgtgaaaatg       180
     ggtgcgcatc cgggcttgcc ggatttactc ggttttgggc gccgcaatat ggcgatttct       240
     cctgaggaag cgtatgatct tgtcgtttat caaattggcg cgctctctgg ctttctaaaa       300
     gcagagggac ttcacatgca gcacgtcaag ccgcatggcg ctttatacaa tatggcggca       360
     gtcgatcaaa aactgtcgga tgctatcgcg aaagctgtct ataaggttga tcccggcctg       420
     attcttttcg gtcttgctga gagcgagctt gtaaaagcgg gagaacggat cggacttcag       480
     accgcaaatg aagtgttcgc cgacagaaca taccaatcgg acggcacgct gacaccgcgc       540
     tcccagccgg acgcactcat tgaaagtgat gatgccgccg tcacccaggt catcaaaatg       600
     gtgaaagaag gggcggtcaa atctcagcaa ggacatgatg tgtcattaaa agcagataca       660
     gtctgcattc atggagatgg agcccatgcg ctgacatttg cgcaaaaaat cagaaaacag       720
     ctcaaagcgg ctggaattga agtgacagct atttcagaac agaggtcaac ataa             774
//

If you have problems or comments...

PBIL Back to PBIL home page