(data stored in ACNUC7421 zone)

EMBL: AL009126.PXPC

AL009126.PXPC        Location/Qualifiers
FT   CDS_pept        460592..461599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpC"
FT                   /locus_tag="BSU_04090"
FT                   /old_locus_tag="BSU04090"
FT                   /product="L-5-oxoprolinase (ATP-dependent) subunit C"
FT                   /function="16.6: Maintain"
FT                   /function="16.8: Protect"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /EC_number="3.5.2.9"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 9334321, 18823995, 19040634,
FT                   20524093, 21050859, 21245531, 22277658, 28830929; Product
FT                   type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04090"
FT                   /db_xref="EnsemblGenomes-Tr:CAE01447"
FT                   /db_xref="GOA:Q7WY77"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="SubtiList:BG14193"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7WY77"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:9334321, 18823995, 19040634, 20524093, 21050859,
FT                   21245531, 22277658, 28830929"
FT                   /protein_id="CAE01447.2"
FT                   /translation="MKVLKPGLLTTVQDIGRTGYQKYGVLASGAMDTVSLRIANLLIGN
FT                   GENEAGLEITMMGPGPSFHFSKQTLIAVTGADFTLRINDEEAPLWKPVLIKENSTVSFG
FT                   PCKLGSRAYLAAAGGIEVPAVMESKSTYVRGSIGGLHGRALQKEDELNIGEMSALSQTI
FT                   LSRLSSQLGKQGFAAPKWSVSRGRFLPLKKNPVIRVLEGKQFAFFTEESKTRFYEEAFR
FT                   VTPQSDRMGYRLKGEPLELKAPLEMVSEAVSFGTVQVPPDGNPIILLADRQTTGGYPRI
FT                   AHIISADLPIVSQIMPGEHVQFEPVSLQEAEALAVEREQHIKELKTRMKMEWLT"
     atgaaagtat taaagcccgg actgctcaca acggttcagg atataggcag aacgggttac        60
     caaaaatacg gcgttctggc cagcggcgct atggacacgg tttcactgcg cattgccaat       120
     ctgttgatag gaaacggcga aaatgaagca ggtctcgaaa taacgatgat ggggcccggt       180
     ccgtcgtttc atttttcaaa acagacactg attgctgtga caggggcgga cttcacgctg       240
     cgtattaatg acgaggaagc gcctttatgg aagcctgtgc tcatcaagga aaacagcacg       300
     gtcagctttg gcccctgcaa actcggcagc cgtgcttatt tggcggcagc tggcggcatt       360
     gaggtgcctg ccgtcatgga aagtaaaagc acatacgtca gaggaagcat tggcggactt       420
     catggcagag cgcttcaaaa agaagatgaa ctgaacattg gagagatgtc agctctttcg       480
     caaaccatcc tttctcgctt aagttcgcag cttggaaaac agggatttgc agcaccgaag       540
     tggtcagtca gccgcggcag atttctgcca ttgaagaaga atcccgtcat tcgggtgctg       600
     gaaggaaagc aatttgcctt tttcacagaa gaatcaaaaa cgcgttttta tgaagaagca       660
     tttcgtgtca cgccgcagtc cgaccgtatg ggctacaggc tcaaaggaga accgctcgaa       720
     ctgaaggccc cgcttgagat ggtgtcggaa gcggtttcat tcggaacagt tcaggtgccg       780
     cctgacggca acccgattat cctgcttgca gaccggcaga cgactggcgg ctatccgagg       840
     atcgcgcaca tcatatccgc tgatcttccg attgtttccc aaatcatgcc gggcgagcac       900
     gttcagtttg agcctgtgtc cctccaggag gcagaagcgc ttgcggtaga acgggaacag       960
     catataaaag aactgaaaac gagaatgaag atggaatggc tgacatag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page