(data stored in SCRATCH zone)

EMBL: AL009126.PXPG

AL009126.PXPG        Location/Qualifiers
FT   CDS_pept        457811..459025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pxpG"
FT                   /locus_tag="BSU_04060"
FT                   /old_locus_tag="BSU04060"
FT                   /product="5-oxoproline transporter"
FT                   /function="16.1: Circulate"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 9334321, 15849754,
FT                   16850406, 28830929; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU04060"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12214"
FT                   /db_xref="GOA:P42964"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="SubtiList:BG11228"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42964"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB12214.3"
FT                   /translation="MEQQKKTAGKKAGSWSLLMGAAFLMATSAIGPGFLTQTATFTNTL
FT                   AASFGFVILISIILDIFAQTNVWRIIAVSGKRGQEIANMVLPGLGYFIAILVVLGGLAF
FT                   NIGNIGGAGLGLQVLFGITPETGALISAVIAILIFVIKEAGKAMDRFTQIAGFVMIILT
FT                   VYVAATTAPPVGQAVANTFVPEHISIFAIVTLVGGTVGGYITFAGGHRLLDAGIKGKES
FT                   IPQVTKSSVVGILITSVMRIALFLAVLGVVSKGLHIDESNPAASVFKLAAGNVGYKIFG
FT                   LIMWSAAITSVIGAAYTSVSFFKTFSPKIEKNSRGIIIGFIVVSTLAFVTIGQPAKILV
FT                   LVGSLNGLILPIALGTLLVAAYKKNIVGDYKHPLWLTSTGALVVIVMAVMGIYTLCTQL
FT                   PQLWS"
     atggagcagc agaaaaagac agcaggaaaa aaagcgggca gctggtcatt gctgatgggc        60
     gccgcctttt taatggcgac atcagcaatc ggaccgggtt tcctcaccca aaccgcaaca       120
     ttcacaaaca cactcgcagc aagcttcggt tttgtcatct taatctctat tattttagat       180
     attttcgccc aaaccaatgt gtggcgcatc atcgcagttt ctggaaaacg aggtcaggaa       240
     attgcgaata tggtgcttcc cggactgggg tatttcatcg ccattctcgt cgtgcttggc       300
     ggactagctt ttaatattgg gaatatcgga ggggccgggc tgggacttca ggtgctgttc       360
     ggcattacac ctgaaacagg cgctttaatc agtgccgtta tcgccatttt gatttttgtc       420
     atcaaggaag caggaaaagc gatggaccgt tttacgcaaa tcgcggggtt cgtgatgatt       480
     attttaacgg tctacgttgc ggcgacgaca gctcctccgg tcggacaggc agtcgcaaat       540
     acattcgtcc cggaacacat cagcatattt gccattgtca ccctagtggg cggaaccgtc       600
     ggcggttata tcacatttgc cggaggacac cgtttgcttg atgccggaat taaaggaaag       660
     gaatccattc cgcaggtgac aaagagctcg gttgtcggca ttttaattac atctgtcatg       720
     cgtatcgctc tttttcttgc ggttctaggc gttgtatcga aaggcctgca catcgatgaa       780
     agcaacccgg cggcttctgt cttcaagctg gctgctggaa atgtcggtta taaaattttc       840
     ggattgatca tgtggtctgc ggcgattacg tctgttattg gagcagccta tacatctgtt       900
     tcatttttta aaaccttttc tccaaaaatt gaaaagaatt cacgcggtat tattatcgga       960
     tttattgtgg tttctacgtt agcttttgtc acaatcggcc agcctgcgaa gatcctcgtc      1020
     cttgtcggtt cactgaacgg cttaattctg ccgattgcgc tcggaacgct gcttgttgcc      1080
     gcctacaaga aaaacattgt cggtgattat aagcatccgc tttggctgac aagcacaggc      1140
     gcgcttgtag tgattgtaat ggcagttatg ggaatctaca cgttatgtac acaacttcct      1200
     caattgtgga gctga                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page