(data stored in ACNUC7421 zone)

EMBL: AL009126.RADA

AL009126.RADA        Location/Qualifiers
FT   CDS_pept        106096..107472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BSU_00870"
FT                   /old_locus_tag="BSU00870"
FT                   /product="DNA repair protein; 6-O-methylguanine-DNA
FT                   methyltransferase"
FT                   /function="16.6: Maintain"
FT                   /EC_number="2.1.1.63"
FT                   /note="Evidence 2b: Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId: 10931349, 11810266,
FT                   15317759, 25616256; Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00870"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11863"
FT                   /db_xref="GOA:P37572"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="SubtiList:BG10149"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37572"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAB11863.1"
FT                   /translation="MAKTKSKFICQSCGYESPKWMGKCPGCGAWNTMVEEMIKKAPANR
FT                   RAAFSHSVQTVQKPSPITSIETSEEPRVKTQLGEFNRVLGGGVVKGSLVLIGGDPGIGK
FT                   STLLLQVSAQLSGSSNSVLYISGEESVKQTKLRADRLGINNPSLHVLSETDMEYISSAI
FT                   QEMNPSFVVVDSIQTVYQSDITSAPGSVSQVRECTAELMKIAKTKGIPIFIVGHVTKEG
FT                   SIAGPRLLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEMGIFEMREEGLTEVLNPS
FT                   EIFLEERSAGSAGSSITASMEGTRPILVEIQALISPTSFGNPRRMATGIDHNRVSLLMA
FT                   VLEKRVGLLLQNQDAYLKVAGGVKLDEPAIDLAIVISIASSFRDTPPNPADCFIGEVGL
FT                   TGEVRRVSRIEQRVKEAAKLGFKRMIIPAANLDGWTKPKGIEVIGVANVAEALRTSLGG
FT                   "
     atggctaaaa caaaatcgaa gttcatctgc caatcctgcg gctacgagtc tccaaaatgg        60
     atggggaaat gtccgggctg tggtgcttgg aatacaatgg tggaagaaat gattaaaaaa       120
     gcaccggcca atcggagagc ggctttttct cattctgttc aaactgtaca gaaaccttca       180
     cctattacat caatcgaaac atcagaagaa ccccgcgtca aaacccagct tggcgagttt       240
     aacagagtac tcggcggagg tgtcgttaaa ggctccctcg ttttaattgg cggtgatcct       300
     ggtatcggaa agtcaacgct attactgcag gtttccgctc aattatcagg ctcatcaaac       360
     agtgtcctgt atatttcggg agaagaatct gtaaagcaaa cgaagctgcg agcagaccgt       420
     ctcggcatta ataatccgtc actgcatgtt ttatctgaaa ccgatatgga gtatatttcg       480
     tctgctatac aagagatgaa tccatcgttt gtcgttgttg actctattca aacggtttac       540
     caaagcgata ttacatctgc tccaggcagt gtgtcacagg tcagagaatg taccgctgag       600
     ctgatgaaaa ttgcaaaaac aaaaggtatt ccgattttta tcgtagggca cgtgacgaaa       660
     gaagggtcta ttgcaggtcc gagactgttg gagcatatgg ttgacactgt tttatatttt       720
     gaaggagaac gccaccatac tttccgtatt ttgcgggctg taaaaaaccg tttcggatct       780
     acaaacgaaa tgggcatttt cgaaatgcgg gaagaggggc tcactgaggt tttgaatcct       840
     tcggaaattt tcttagaaga acgctctgct ggttccgcag gctcgagtat cactgcctct       900
     atggagggca ctagaccgat tctcgttgaa attcaggcac tcatctcgcc aacaagtttt       960
     ggcaacccaa ggcgtatggc aacgggaata gaccataaca gggtttctct gttaatggct      1020
     gtgttagaaa aaagagttgg actgctgctg caaaatcagg atgcttattt gaaagtggct      1080
     ggcggcgtta agcttgatga accggcaatt gatcttgcga ttgtgattag tattgcatca      1140
     agctttagag acacacctcc aaatcctgca gattgtttta ttggagaagt gggattaacc      1200
     ggagaagtcc ggcgggtttc aagaattgaa cagcgtgtga aagaagcggc aaagcttggt      1260
     tttaaacgca tgatcatacc cgcggcaaat ctggatggat ggacaaaacc aaaagggatt      1320
     gaggttatcg gagtagcaaa tgttgcagaa gcgcttcgta cttcattagg aggataa         1377
//

If you have problems or comments...

PBIL Back to PBIL home page