(data stored in SCRATCH zone)

EMBL: AL009126.RAEA

AL009126.RAEA        Location/Qualifiers
FT   CDS_pept        116025..116537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="raeA"
FT                   /locus_tag="BSU_00970"
FT                   /old_locus_tag="BSU00970"
FT                   /product="ribosome-dependent mRNA endonuclease"
FT                   /function="16.11: Scavenge (Catabolism)"
FT                   /function="16.6: Maintain"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 17114934, 23355615, 28363943;
FT                   Product type e: enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU00970"
FT                   /db_xref="EnsemblGenomes-Tr:CAB11873"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="PDB:5MQ8"
FT                   /db_xref="PDB:5MQ9"
FT                   /db_xref="SubtiList:BG10158"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37574"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:17114934, 23355615, 28363943"
FT                   /protein_id="CAB11873.1"
FT                   /translation="MDILLVDGYNMIGAWPQLKDLKANSFEEARDVLIQKMAEYQSYTG
FT                   NRVIVVFDAHLVKGLEKKQTNHRVEVIFTKENETADERIEKLAQALNNIATQIHVATSD
FT                   YTEQWAIFGQGALRKSARELLREVETIERRIERRVRKITSEKPAGKIALSEEVLKTFEK
FT                   WRRGDLD"
     atggatatcc tgttagtaga cgggtacaac atgattggag cctggccgca gctgaaggat        60
     ttaaaagcga acagttttga agaggcgaga gacgtactga ttcagaaaat ggcggaatat       120
     caatcgtata caggaaacag ggttattgtt gtttttgacg cgcatctcgt aaaagggctt       180
     gagaaaaaac agaccaacca tagagttgaa gtaattttta caaaagaaaa tgagacggct       240
     gatgagcgga tagaaaagct cgctcaggct ttgaataata ttgcgactca aattcacgtt       300
     gcgacctctg actatactga gcagtgggcg attttcggac agggggcatt gcggaaatcg       360
     gcccgggagc ttctgagaga ggtagaaacg attgaaaggc gaatagagag acgggtaaga       420
     aaaatcactt ccgaaaagcc ggcgggtaaa attgctttat cggaagaggt tttgaaaacg       480
     tttgaaaagt ggaggcgggg agacttagat taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page