(data stored in SCRATCH zone)

EMBL: AL009126.RAPC

AL009126.RAPC        Location/Qualifiers
FT   CDS_pept        428831..429979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapC"
FT                   /locus_tag="BSU_03770"
FT                   /old_locus_tag="BSU03770"
FT                   /product="response regulator aspartate phosphatase"
FT                   /function="16.3: Control"
FT                   /note="Evidence 1a: Function from experimental evidences in
FT                   the studied strain; PubMedId: 10464187, 12456319, 12897006,
FT                   12950917, 15968044, 19202088; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BSU03770"
FT                   /db_xref="EnsemblGenomes-Tr:CAB12185"
FT                   /db_xref="GOA:P94415"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="SubtiList:BG11966"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94415"
FT                   /experiment="publication(s) with functional evidences,
FT                   PMID:10464187, 12456319, 12897006, 12950917, 15968044,
FT                   19202088"
FT                   /protein_id="CAB12185.1"
FT                   /translation="MKSGVIPSSAVGQKINEWYRYIRTFSVPDAEVLKAEIQQELKHMQ
FT                   HDSNLLLYYSLMEFRHQLMLDYLEPLEKLNIEDQPSLSELSRNIDSNQADLKGLLDYYV
FT                   NFFRGMYEFDKREFISAITYYKQAEKKLSFVADHIERAEFYFKIAEAYYYMKQTYFSLI
FT                   NIKNAYEIYVEQETYNVRIIQCHFVFGVNLMDERNFEQAARHFKLALNMAQAEQKAQLV
FT                   GRAYYNLGLCYYNQDLLDPAIDYFEKAVSTFESSRIVNSLPQAYFLITLIYYKQGKHDK
FT                   ASEYHKRGYEYAKETDDADYAVKFEFLQSLYLDQPNEEGIERCFQYLKNKNMYADIEDL
FT                   ALEVAKYYYEQKWFKLSASYFLQVEEARKQIQRSEGLYEIEI"
     atgaagagtg gggtaattcc ttcttcagcg gtcggtcaaa aaattaacga gtggtacaga        60
     tatatccgga cattcagcgt gccggatgcc gaagtgttaa aagctgaaat ccagcaggaa       120
     ctgaaacaca tgcagcatga ttccaacttg ctgctttatt attcactaat ggaattccgg       180
     caccagctta tgctggatta tcttgagccg ttagagaaat taaatatcga agaccagcca       240
     agcctgtctg aattatcaag aaacattgac agcaaccagg cagatctcaa agggctgctc       300
     gactattacg tgaatttttt tcgcgggatg tatgaatttg ataagcggga atttatttct       360
     gccattacat actataaaca ggcggagaaa aagctctcct ttgtcgcaga ccatattgaa       420
     cgggctgaat tctattttaa aatcgcggaa gcttattatt atatgaagca aacgtatttt       480
     tcattgatta atataaaaaa cgcctatgaa atttacgtgg agcaggaaac ctataatgtg       540
     agaatcattc agtgccattt cgtcttcggg gtcaacctga tggatgaaag aaatttcgaa       600
     caagccgcac gccatttcaa attggcgctc aacatggccc aagcagaaca aaaagcccag       660
     ctggttggaa gagcatacta caatctcggg ttatgctatt acaatcaaga ccttctagac       720
     cctgccattg attactttga aaaagcggtc tccacatttg aaagcagcag gatcgtcaat       780
     tctctcccgc aagcctattt tttaatcacc ctgatttatt ataaacaggg aaaacatgat       840
     aaagcttcgg aatatcacaa gcggggctat gaatatgcta aagaaacaga cgatgcagac       900
     tatgccgtaa aattcgagtt tttgcaatcc ctatatctgg atcagcccaa tgaagaagga       960
     atcgaacgat gtttccagta cttaaaaaat aaaaatatgt acgctgatat agaggattta      1020
     gccctagaag tagcaaaata ttactatgaa cagaaatggt ttaaactgtc tgcttcctac      1080
     tttctacaag ttgaagaggc aagaaaacaa atacaaagga gtgaaggttt gtatgaaatt      1140
     gaaatctaa                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page